PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0023s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family SBP
Protein Properties Length: 793aa    MW: 88280.8 Da    PI: 5.5923
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0023s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1071.3e-33139216178
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           +Cqv++C adl+++k+yhrrh+vC ++++a++v ++++ +r+CqqC+rfh ls+fDeekrsCr++L++hn+rrr+k +
  Sphfalx0023s0010.1.p 139 RCQVPACGADLASLKSYHRRHRVCLHCANATSVKLHQRLHRYCQQCGRFHVLSDFDEEKRSCRQKLERHNNRRRQKVQ 216
                           6*************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.1E-25136201IPR004333Transcription factor, SBP-box
PROSITE profilePS5114127.59137214IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-29138217IPR004333Transcription factor, SBP-box
PfamPF031103.8E-25140213IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 793 aa     Download sequence    Send to blast
MMGHSVETMM GWEWDSLLLL INPAIADTSD GGGVVGDALL DSAACGFSVG QSWPEFEDFD  60
TGPGILVEEE EETQRQQFAK TKPQYRDSTE KAGNEERRDP RLDCPNFLAG RVPCACSDNE  120
DEEEEGGGSH SKRVKLSARC QVPACGADLA SLKSYHRRHR VCLHCANATS VKLHQRLHRY  180
CQQCGRFHVL SDFDEEKRSC RQKLERHNNR RRQKVQESGE DTTTITIDND NPSLEEGKDG  240
KSMVEEKATV DNEVQSDADR SCSLVAPTIP LLAEQLKTTD EAHPSLPNPN ASNTMMPDHM  300
HNHAPKSQVL TPIQPGHLWD PGPKEQSVEK GEVGVRKVGV DEDSLLALLL EEAPDEVNHL  360
RHMSDLPTVI STRERDRSST YTARYPSGQI SFKLYDWNPG DFPRNLRQQI LEWLSNMPVE  420
LEGYIRSGCT ILTLFIAMPQ SMWDKLYVDW AGAVRKLVQG PQSVAGFWDQ GYFKAKLGWK  480
TVHFVDGQLV NRSGGKKECM PCMPVLKSVQ PICFEAASEG QLTVSGENLL HPNTRLLVSA  540
GGKYLNAYVV QSCHENEEDE WKIIIPALDC SQVGPLFIEV ENEGGTSNSM TVLVGDRNLC  600
SELERLELEV SRGCEQDLVF DLGWMLRDSS CQHSGACSRL QDLFLYAKAC GWHSLAEYVL  660
QAAGRKGMLP EVTKVGDKTY PFRGDMDAPQ ALMVLPTMVL EWNSAHLLPP FKKDRKFGKK  720
DVHITVDSGR DTLVPLIPKQ RRGSCNQSWG TYRVMAAVAT VTAACAGVCL VLVHPDEVIQ  780
LSTSLHHRLW GQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A1e-29138219485squamosa promoter binding protein-like 7
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024372070.10.0squamosa promoter-binding-like protein 9 isoform X1
RefseqXP_024372072.10.0squamosa promoter-binding-like protein 9
TrEMBLA0A2K1KWR80.0A0A2K1KWR8_PHYPA; Uncharacterized protein
STRINGPP1S55_237V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.31e-49squamosa promoter binding protein-like 7