PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0021s0082.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 762aa    MW: 81489.4 Da    PI: 7.229
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0021s0082.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-32109162255
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           prlrWt++LH++Fv+ave+LGG+e+AtPk +l+lm+vkgLt++hvkSHLQ+YR+
  Sphfalx0021s0082.1.p 109 PRLRWTTDLHHCFVHAVERLGGQERATPKLVLQLMEVKGLTIAHVKSHLQMYRS 162
                           8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-31105164IPR009057Homeodomain-like
PROSITE profilePS5129410.049105165IPR017930Myb domain
SuperFamilySSF466899.68E-15107164IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-23109163IPR006447Myb domain, plants
PfamPF002494.4E-8110161IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 762 aa     Download sequence    Send to blast
MQSTEECSNG CVEEEKCAGG GHGIKSRSKS TPHITAAVSS SGEDHEYVVE QSSESHNTTT  60
AAGGPSSPVS TGNQGCQGGS TSSAAGGGAA GSCRPGGTTV RQYMRSKMPR LRWTTDLHHC  120
FVHAVERLGG QERATPKLVL QLMEVKGLTI AHVKSHLQMY RSMKNDEIGQ ISGRLAAAVA  180
HNDDQRFDFR DTDSDGTVCC SLQLMNPASR RFHPFAHEPG QTSCADRDRD SAAVMTGQQL  240
PAAGALNTQP GHDTGEFSAH ADRIMIHDFL RHPAGAAPGV IVQRHESAGL AEADQHLTIS  300
LRQNGPGEWV IPARPAPAAA VATESLQTRA APTGVLRDWP HHSGEAKNDT ITNWDGARGE  360
HQQARALTAA VPAGITLPGH SIDLRTQLDE WSRKPSPSLL SADSWNQRQQ RGRRPALTHV  420
EAGAAGGGGR MHQLSRVAGA HHDEISMHHQ LLHHPTLDHV GVPEPAGGSD SWTKKQRILQ  480
QVESCCKWER WRSSDHHEAL PRMEWGPKAT FAHCGGSAAH AMASTASSVA SPLQFRQLID  540
CSCGSRSVHG EEQQRAPRGL AGELAAGAAA GGDCSTSGSW HMSEMQQKLS LTQSQIRSND  600
KQAGSAENYY KSRFSGADQL PAREQPLKPA CRALQQPIPK MSLESGRFWR QAAAGSLQQQ  660
QSTEPQVIDC NQLQLLADNQ PELDCNTTSL SLSPYSSRTK SYSPPAAASW ITRSLSLPPG  720
ITSNEDSDCL SLQHISRESG AVQQVPPKGI TLDLTMSIGG P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-17110164357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-17110164357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-17110164357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-17110164357Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.15e-30G2-like family protein