PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0016s0215.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 703aa    MW: 74777 Da    PI: 6.2049
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0016s0215.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.37.4e-33371425155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+rlrWtpeLHe+Fv+av+qLGG+++AtPk++l+lm+v+g+t++hvkSHLQkYRl
  Sphfalx0016s0215.1.p 371 KTRLRWTPELHEKFVNAVSQLGGADRATPKAVLRLMGVQGITIYHVKSHLQKYRL 425
                           68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.044368428IPR017930Myb domain
SuperFamilySSF466892.69E-17370425IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-24371426IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.7E-31371426IPR009057Homeodomain-like
PfamPF002491.2E-9373424IPR001005SANT/Myb domain
PfamPF143796.9E-21457502IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 703 aa     Download sequence    Send to blast
MLMNRQGIEG WQPPQMTNSH AAGPSADVVT MPTPQLNPQL TYTQPNMTKA QGGGGGAAWP  60
AVEASSRSSS ASLQPRHGYY QSPQMDNQQM GMQGDPAAVA MASQYQYLPP QGQYLAQPGP  120
GAQWPNLHAH GHPHPLPHHP HSQQQGHWQG GSQQLLPSAA LAVHNPPPTL ARSGVVAGSH  180
HPLRVGSGGQ QQQQENPGGG GVSAAYSLEH TGRESNQAFQ DVNLGVAAEG QSGLSAALLH  240
SAPDQAIGPK TEDRDDTDLG DQLQVLLDSA DGDGTDSPQM GEQSMNGVAT GAEWLTWTEL  300
VPDEETIANC WTEIIDVESG DERTLFQTTR FEPLAPTTLQ PRGPHADYQA AGSARGQCPE  360
SPGPSSAAAV KTRLRWTPEL HEKFVNAVSQ LGGADRATPK AVLRLMGVQG ITIYHVKSHL  420
QKYRLAKYIP EISEEARAER RQNDAYLSPM GINSTHQITQ ALQLQMEVQK RLHEQLEVQR  480
ELQLRIEAQG KSLQKMIEQQ AKVGGLVLGY RSEPQHPSSS AIVSATPLAE SSGLSSRISI  540
NEGPLPASTI ESAIPVTDRA PLPASNVDQP NPKHVLISAQ KAVSQEQPPP TLIASNDESL  600
SKRARTEFNS QLGSSVQVPM SVASDIQRGG GSATQQNARQ AGEFEASPGM VTKLASPAVE  660
AWAAVEGEQA HSFLQLPPQQ GHTACAQPHP SSVPHKPVHA SG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-23371428158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-23371428158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-23371428158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-23371428158Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.15e-63G2-like family protein