PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0010s0233.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 531aa    MW: 57658.6 Da    PI: 4.8448
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0010s0233.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.98.4e-32318373156
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           k r++Wt eLH+rFv a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Sphfalx0010s0233.1.p 318 KSRRCWTAELHRRFVGALQQLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 373
                           68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-28315376IPR009057Homeodomain-like
PROSITE profilePS5129413.158315375IPR017930Myb domain
SuperFamilySSF466891.94E-17316376IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-26318373IPR006447Myb domain, plants
PfamPF002493.6E-6320371IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    Send to blast
MESPVDLTLG SAHTASSSYT NATNTVNGLE SSLSFVGDHL ERIRKIEEYL QALEDERRKI  60
EAFKRELPLC MQLLEETIES SKEQLAENGV LPTTQLPVGA AAVSSPTRLR GLEFMPLKAQ  120
AWERQQQKDE GDDHDQEGDG SECPGVVDIE KMTWMTEAQL WTQQLEPSSE LHCENDRMSM  180
EEDMGRHPNF DQSEQEQCSV TSSRFELFSS KQPPAGAFLP FVGEQQVVTA APPPSGSTTG  240
TTGSGADLSL SSLDHVSSPN GNGFGGAESE VGSIDVTRLR TPDRILDAQG CNLGIRPQSN  300
GVSEAGSTRV FGSQSQRKSR RCWTAELHRR FVGALQQLGG SQVATPKQIR ELMKVDGLTN  360
DEVKSHLQKY RLHTRRRSTS SQSVSLEAPQ MVGMWVPLEC AVAQAAAQPT SGVYDPSPPS  420
YCQPSHPQDY FTCNMSTGSS GGQLKQHPTT FEPQKSSLLS QSSPQGPLQL SSQLSGGAQE  480
LSNEDSGGGD VKSDSTSWKS CQLDVIEGKE SGRSIQHTVK QDNNGQQIKR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-13318371154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13318371154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13318371154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13318371154Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.17e-35G2-like family protein