PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0009s0225.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 580aa    MW: 62145.2 Da    PI: 6.799
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0009s0225.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.61.3e-3348102155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+rlrW+peLHerFv+av+qLGG+++AtPk +l+lm+v+gLt++hvkSHLQkYRl
  Sphfalx0009s0225.1.p  48 KQRLRWSPELHERFVDAVSQLGGPDRATPKGVLRLMGVQGLTIYHVKSHLQKYRL 102
                           79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.47145105IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-3246103IPR009057Homeodomain-like
SuperFamilySSF466892.15E-1747102IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-2548103IPR006447Myb domain, plants
PfamPF002491.2E-950101IPR001005SANT/Myb domain
PfamPF143795.3E-23147193IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    Send to blast
MYHHHHHHHT KRFNGVTAAA ATNFASSANQ TSPAGGGASS GAAAAAAKQR LRWSPELHER  60
FVDAVSQLGG PDRATPKGVL RLMGVQGLTI YHVKSHLQKY RLAKYVPDSA SDGGTSKVDQ  120
KSNKKKNPAA AAQPDIILPA SDSTSGVQVD DALRMQMEVQ KRLHEQLEVQ RHLQLRIDAQ  180
SKYLKKIIEE QQRVGGSTNT TTTTTTHDDT KLHTVAAASV NERGLGRSHS LMAAAADDQE  240
PSSNEEVCIV CQDDDDDKKQ QQHDQHQIPD LRLSVVVTPG EEAGIVTDDD AYKLACSKAS  300
SNEQAGASIS PPGIRELHFE IMRSSESTTS QASSARTTTQ LQQQQQQQQQ HQSTRVAQYN  360
MGTGSLYTAS LNSTFTSSWT PSSQSPSKRT RFAGHGEIVA TGQQPGSSQS VSSELEPVVQ  420
QHDGGIMVAT CTTSSGGSDF QHQSIHLVQR VVTPGFPLSS PASNCDHSDF KLAMDFPLGG  480
GSSSSNLQQA PPANLAAALY TSQTSDLHSL TGDDLTLRPL RSSSSSLQGS HIVAMDQQWA  540
ERPSTTTAES DSASDAVRQM FSRWEENSGN AVAHSQGKT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-2347105159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-2347105159Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-2348105158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-2348105158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-2348105158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-2348105158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-2347105159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-2347105159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-2347105159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-2347105159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-2347105159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-2347105159Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-63G2-like family protein