PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0005s0159.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family NF-YC
Protein Properties Length: 375aa    MW: 39854.8 Da    PI: 4.3848
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0005s0159.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC28.43.5e-092553242089
                 NF-YC  20 elPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdif 89 
                            +P +r+k+i+k d+d+k ++++  +l+++a  lf+  l+   +    ++k ++++ + +  a +++  f
  Sphfalx0005s0159.1.p 255 PFPQSRVKRIIKLDPDIKLVASDGIALITQATALFLESLAAAVFSSMVQSKHKSVRGQHVILAAKSSRRF 324
                           589*****************************************************99999988888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF470956.68E-9140202IPR009071High mobility group box domain
SMARTSM003987.5E-4142228IPR009071High mobility group box domain
PROSITE profilePS5011810.386143206IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.6E-9145205IPR009071High mobility group box domain
CDDcd013909.83E-9145196No hitNo description
PfamPF005051.8E-7147203IPR009071High mobility group box domain
PfamPF008083.0E-10256317IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.106.7E-11256324IPR009072Histone-fold
SuperFamilySSF471132.0E-9256323IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MASMHAEEEE GTDAGSRCFE KELEESPGMC GVASDVEVFE GIPPVKSRDE ESQIMDSFAA  60
DQEVVIVESA AEESNEKKRL ALASNADDIQ QNRTVVLEAT DAQELQTVDS LEENQEAASE  120
GDNARAVNGA VVSTDTNKSA PGNTKRLSSY FSFANENREA VKAELQVAGK PATASAVAKV  180
LGERWRALTD AEKQAFSRQQ DRSSEKSSCL LTKGRKPQQA KDMPVAQGEF SAGDGGDGSP  240
DEGDGNLGAE EFTAPFPQSR VKRIIKLDPD IKLVASDGIA LITQATALFL ESLAAAVFSS  300
MVQSKHKSVR GQHVILAAKS SRRFCDCVGN DIASLLNTSS QLGDESDGEV EADEDGNDGA  360
TLAQPHRKKA ARKV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.13e-08nuclear factor Y, subunit C10