PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0004s0229.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 624aa    MW: 67018.4 Da    PI: 4.942
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0004s0229.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-31366421156
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           k r++W+peLH+rFv a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Sphfalx0004s0229.1.p 366 KSRRCWSPELHRRFVCALQQLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 421
                           68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-29363424IPR009057Homeodomain-like
PROSITE profilePS5129414.075363423IPR017930Myb domain
SuperFamilySSF466899.14E-17364424IPR009057Homeodomain-like
TIGRFAMsTIGR015577.4E-26366421IPR006447Myb domain, plants
PfamPF002499.3E-8368419IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MGSPADLTLG TSQAPSTNAT TNTAAATTTT TVLSKSSPSS FVGDRLQRMR KLEEYLQSLE  60
DERRKIEAFK RELPLCMQLL DETIESSKEQ LSAIQALRPT NLRGPLQLLQ VVTQSSSQQL  120
VQDERDTGTT VSSPAASGGH QRGLEFIPLK RLSETQQLRD DEGDDDDDDD DDDRELGDQS  180
DSCLATRGID IGRKAWMAEA QIWTQQSEPM EVHHEKEISS PEDVVGRQEH FGQSPEQEQS  240
SVTSSRLFFS STQRPAGAFL PFIRGLQQVT AVAPLLSHST NGTASAAAAD RSLSSLDQMS  300
SPTNGHGFGG GAESEVGSID VVSLKTADQN QTLDAQAYKE MQGPESNGAS GAGSTSVGIV  360
SHSHRKSRRC WSPELHRRFV CALQQLGGSQ VATPKQIREL MKVDGLTNDE VKSHLQKYRL  420
HTRRPSPSPQ SVSQQPPPQL VVLGGIWVPP EYAAVAAAAA QPTSGVYNPS QQSVYCQPSH  480
PQDYFMHNNS TGSSGGQNVH HHPPTSFEPQ KSTSVSQSSP QGPLQLTSQL SGGAQEPSLD  540
DTGGEDVKSD STSWKGHQQE DEGKETANGA NKQSSVSKED NKAGKSRDKT PGGEIFADHN  600
SPVLELQISC GTSDIDMGVK DVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-14366419255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-14366419255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-14366419154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-14366419154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-14366419154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-14366419154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-14366419255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-14366419255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-14366419255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-14366419255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-14366419255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-14366419255Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.16e-38G2-like family protein