PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0004s0125.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 428aa    MW: 45811.1 Da    PI: 6.511
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0004s0125.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.93.1e-30241294155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           +prl+Wtp+LH+rFv+av +L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Sphfalx0004s0125.1.p 241 RPRLVWTPQLHKRFVDAVGHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 294
                           59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.04E-19238298IPR009057Homeodomain-like
PROSITE profilePS512949.927238297IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-30240299IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-24242294IPR006447Myb domain, plants
PfamPF002492.6E-7244293IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MMVKEDDAHV SEWEDGLPTD EELTPLSHSL ISPALASAFS IEHEPAKTAM DVQRGSRDTL  60
HNLRNNKAPI TSFDSFPSFK GHENRGGHGY VGDARVGDGS GGSGKAVGGN GGIGSSNEAE  120
RVIGGANQPG PSSHPTGPYP VARAGLAAPG NYIGGSDETS FNPGDEQLDQ GSLPYMMSYA  180
GGSSYERRPE NSYGAIGDDS NKGGGTSKNV HKRGDSESED DDSAGGPENS GEEPNARTLK  240
RPRLVWTPQL HKRFVDAVGH LGIKNAVPKT IMQLMNVEGL TRENVASHLQ KYRLYLKRMQ  300
GLSSEGPSAS DHLFASTPIP PNLGGPHYMP NHRDDVGPLP FASPNVPIPY TAIAPYPIGP  360
GHYGGYEQYP YSAVGRGLPQ QSPRGDHREA MMDNRNHQNH SHNYNHNHNQ PSSPPQRILT  420
LFPTSSH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A1e-33241297157Transcription factor LUX
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024385661.11e-122uncharacterized protein LOC112287146 isoform X1
TrEMBLA0A2K1K3551e-111A0A2K1K355_PHYPA; Uncharacterized protein
STRINGPP1S29_32V6.11e-121(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.38e-51G2-like family protein