PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0004s0083.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family SBP
Protein Properties Length: 673aa    MW: 72119 Da    PI: 6.4469
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0004s0083.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.19.3e-42210286177
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                           +CqvegC+adls+ak+yhrrhkvCe+hska++++++g+eqrfCqqCsrfh l+efDe krsCrrrLa+hnerrrk++
  Sphfalx0004s0083.1.p 210 RCQVEGCTADLSSAKDYHRRHKVCEMHSKASKAIAAGREQRFCQQCSRFHVLTEFDEIKRSCRRRLAGHNERRRKPH 286
                           6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.6E-35206272IPR004333Transcription factor, SBP-box
PROSITE profilePS5114133.291208285IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-39209288IPR004333Transcription factor, SBP-box
PfamPF031102.4E-31211284IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 673 aa     Download sequence    Send to blast
MAMAMTEAHE RRWINTTWEL QQQQNPENSE GMRDGEAGAG GDYGSALLSS RVDWDLKDWE  60
SITLAYPTSD ENCCSSSSLP ETVMVSAAVV KSEPQAEVEE SEEEEEDEVV HQAPEAAAAA  120
PLKLGLKLGR RSSSSSTEKN KKEKSVSQGS CSTTTPTAAI APPPAAVAVA VAAGSSSSSP  180
PSTKKQRVTS PSSAAAAAGG GIQNPAPPPR CQVEGCTADL SSAKDYHRRH KVCEMHSKAS  240
KAIAAGREQR FCQQCSRFHV LTEFDEIKRS CRRRLAGHNE RRRKPHLESS SSAAAAAAAS  300
NLSFNCRISS PMRSTDAFHI HGTAADSLSL DDCKQTQFLE QIQGSQGGGR PLSSPDLHDD  360
DEHSNHHHPF ANVLNLSSPW RPGENVRSPQ HIQQVEEKEG QLMMLDRRYG TPSSNRLLMF  420
LQSPRGQMRG ALDPSPDVGL SNLSPLVVGG GGSSQEFVDG AKGSLCQNLS LGGGGGWENN  480
NHHNYHHNQG CESQSSGCAL SLLSWGTTPC PPALDLCVDN TSLDHHHHHQ LVADNNMGSN  540
TVASFATHHL PQQQSQEHYL AFEKLFSAQS GSLGAMGISD IRITDIQQQQ QPLEQSQLHG  600
VGGGGGGGDD GASVCRCISS IISIRFILLL LLVCIRRCKH PSMEEEESMA SLVPRFVLLR  660
APCSAPNICS RS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-322112841184squamosa promoter binding protein-like 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-34SBP family protein