PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0002s0406.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family ARF
Protein Properties Length: 796aa    MW: 88061 Da    PI: 6.4198
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0002s0406.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.94.7e-24145244197
                           EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                           f+k+lt sd++++g +++p++ aee+       ++++++ +l+ +d +g +W++++iyr++++r++lt+GW+ Fv++++L +gD+v+F 
  Sphfalx0002s0406.1.p 145 FCKTLTASDTSTHGGFSVPRRAAEEClpeldyTMNPPCQ-ELVAKDVHGVEWKFRHIYRGHPRRHLLTTGWSVFVSSKRLVAGDSVLFL 232
                           99*****************************97777785.9************************************************ PP

                           E-SSSEE..EEEEE CS
                    B3  84 ldgrsefelvvkvf 97 
                           +   ++++l+v+v+
  Sphfalx0002s0406.1.p 233 R--GENEQLRVGVR 244
                           3..37777899997 PP

2Auxin_resp114.11.3e-37271353183
            Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                           aaha+++k  F+v+Y+P+++tseFv++++k++ka+k++vsvGmRfkm+fe+eds err++Gt++g+ d+d vrWpnS WrsLk
  Sphfalx0002s0406.1.p 271 AAHAVTEKLRFSVIYHPSTCTSEFVIPYHKYLKAIKSSVSVGMRFKMRFESEDSTERRYAGTITGIGDVDAVRWPNSYWRSLK 353
                           79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.57E-40138259IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.0E-39138258IPR015300DNA-binding pseudobarrel domain
CDDcd100176.02E-23144244No hitNo description
SMARTSM010197.1E-23145247IPR003340B3 DNA binding domain
PROSITE profilePS5086312.196145247IPR003340B3 DNA binding domain
PfamPF023626.6E-22145244IPR003340B3 DNA binding domain
PfamPF065073.4E-34271353IPR010525Auxin response factor
SuperFamilySSF542773.38E-11690772No hitNo description
PfamPF023091.1E-5692730IPR033389AUX/IAA domain
PROSITE profilePS5174529.221694777IPR000270PB1 domain
PfamPF023095.6E-6741772IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 796 aa     Download sequence    Send to blast
MRSSSTGMTS QHISPPMSQC PLPSSCDSSP ADISGNDELD SEFWHACAGP LISLPVVNSL  60
VVYWPQGHLE QVANSTPQAS SVLSPIPQYD LPPHILCRLT GITLMAHPDT DKVYAQMDLT  120
PVRESEKPSV SEEPPPPAKR KSYSFCKTLT ASDTSTHGGF SVPRRAAEEC LPELDYTMNP  180
PCQELVAKDV HGVEWKFRHI YRGHPRRHLL TTGWSVFVSS KRLVAGDSVL FLRGENEQLR  240
VGVRHALKQQ QDSQSMVVSN QSTYIGVLAT AAHAVTEKLR FSVIYHPSTC TSEFVIPYHK  300
YLKAIKSSVS VGMRFKMRFE SEDSTERRYA GTITGIGDVD AVRWPNSYWR SLKVEWDESM  360
ASGRHERVSL WEIESFNSVA TLPPPTSLGQ YPSQKRRLAR PTLESFHSTK LPRVLVHDKG  420
RLKMREDAEG ATSWRLSGRA VKSEDVLKAP VFGQDRTRAE GWPPMQQSEI CPGAGIRHDL  480
PRGDFTGVLT LEPSQRNVER EQEHLRLCVQ NYLREHQEHK DSFSPRLSST GYGKPECGGD  540
EMQISVNSSS ILDPAMKLSW TSKRPRLSSM PETEDLLSPA PIWPATLSSD LPDCAASSSH  600
LVGARGEFVP SWEDQDGQVL APTPPPARPQ CKLFGFALNA DTVPNPAPST EPPKDEEMDV  660
EHLSSGPTNS GGSNSQELAV KSGALTKVSP FPGRSFIKVY KQGEPGRALD LTRYKSYSEL  720
KHALEDMFSL HGQLESPANL WQLVYTDHEG DILLVGDDPW GEFCSCVRSL KIYSPAVEGG  780
SEDVVQADVQ DTRHT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1263638016359Auxin response factor 1
4ldw_A1e-1263638016359Auxin response factor 1
4ldw_B1e-1263638016359Auxin response factor 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37020.21e-126auxin response factor 8