PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0002s0165.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 680aa    MW: 73137.2 Da    PI: 6.2063
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0002s0165.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.73.5e-30345399155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+rlrWtpeLHe+F+ +v qLGG+++AtPk++l+lm+v+g+t+ hvkSHLQkYRl
  Sphfalx0002s0165.2.p 345 KTRLRWTPELHEKFLTVVGQLGGADRATPKAVLRLMGVQGITIFHVKSHLQKYRL 399
                           68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.823342402IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-28343400IPR009057Homeodomain-like
SuperFamilySSF466891.22E-16344400IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-22345400IPR006447Myb domain, plants
PfamPF002491.5E-7347398IPR001005SANT/Myb domain
PfamPF143795.6E-19431476IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 680 aa     Download sequence    Send to blast
MRLDSGCGAE AGGGRGRGEG GDCGDGEVVA GLQQSSASMR YRHGYCQPSH MDNQQVGLQG  60
DSDLPFQYHY PPQRPYLAQP SSEPETSSPH FRHQRMAPLP SYQSPEHWGL DVQRSNRHPQ  120
GHLHSFPHAH PQQQQGGGHS YVDRQQLLLP SPSAVDRPQQ TLARSSSVSS HPGFRVGCEQ  180
LEKPGGGGSY ALGHTGRESH QNFLNVDLEV ASQSIGVVAH PNSAPDQPIG PKTEEDKDDA  240
DFGDQLKILL DSPDRGGTDS SQMGDRSMND GFGTGAEWLT WTELVPEEET IANCWTEIID  300
VKSGEERTLF QTTRFEPLAP TPVKLGGSPT DQQPSGAAVA AAAAKTRLRW TPELHEKFLT  360
VVGQLGGADR ATPKAVLRLM GVQGITIFHV KSHLQKYRLA KYSPDISDEA RAEWRRSDTY  420
LSPIGINSSH QITQALQLQM QVQKQLHEQL EIQRELQLRI EAQGKSLQKM IEQQAKVGGM  480
VLGYHSEPCD PSSSPLFPAT PVPEILRSSS KIPITGSEGS PLASITEIVI SMTDKTPLPE  540
SNIDQSNPSH GLLSASKAVS QEQPPMSLNA SNEDPLSKRP RTDSKPQVSS FLHVPVSVAS  600
DAQSGGGSAA QGGILQAAGL ETSLEMVTQY ATCQEVEAHT ATEGQLAHSF GKCAPQQAHT  660
ACAQPNPGSI THKPVRASG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A8e-22345402158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-22345402158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-22345402158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-22345402158Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-42G2-like family protein