PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0002s0165.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 695aa    MW: 74583.7 Da    PI: 6.2068
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0002s0165.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.73.6e-30360414155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+rlrWtpeLHe+F+ +v qLGG+++AtPk++l+lm+v+g+t+ hvkSHLQkYRl
  Sphfalx0002s0165.1.p 360 KTRLRWTPELHEKFLTVVGQLGGADRATPKAVLRLMGVQGITIFHVKSHLQKYRL 414
                           68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.823357417IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-28358415IPR009057Homeodomain-like
SuperFamilySSF466891.25E-16359415IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-22360415IPR006447Myb domain, plants
PfamPF002491.5E-7362413IPR001005SANT/Myb domain
PfamPF143795.8E-19446491IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 695 aa     Download sequence    Send to blast
MRLDSGCGAE AGGGRGRGEG GDCGDGEVVA GLQQSSASMR YRHGYCQPSH MDNQQVGLQG  60
DSDLPFQYHY PPQRPYLAQP SSEPETSSPH FRHQRMAPLP SYQSPEHWGL DVQRSNRHPQ  120
GHLHSFPHAH PQQQQGGGHS YVDRQQLLLP SPSAVDRPQQ TLARSSSVSS HPGFRVGCEQ  180
LEKPGGGGSY ALGHTGRESH QNFLNVDLEV ASQSIGVVAH PNSAPDQPIG PKTEEDKDDA  240
DFGDQLKILL DSPDRGGTDS SQMGDRSMND GFGTGAEWLT WTELVPEEET IANCWTEIID  300
VKSGEERTLF QTTRFEPLAP TPVKLGGSPT DQQPSGSAGK QYPESPGLSS GAAVAAAAAK  360
TRLRWTPELH EKFLTVVGQL GGADRATPKA VLRLMGVQGI TIFHVKSHLQ KYRLAKYSPD  420
ISDEARAEWR RSDTYLSPIG INSSHQITQA LQLQMQVQKQ LHEQLEIQRE LQLRIEAQGK  480
SLQKMIEQQA KVGGMVLGYH SEPCDPSSSP LFPATPVPEI LRSSSKIPIT GSEGSPLASI  540
TEIVISMTDK TPLPESNIDQ SNPSHGLLSA SKAVSQEQPP MSLNASNEDP LSKRPRTDSK  600
PQVSSFLHVP VSVASDAQSG GGSAAQGGIL QAAGLETSLE MVTQYATCQE VEAHTATEGQ  660
LAHSFGKCAP QQAHTACAQP NPGSITHKPV RASG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A8e-22360417158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-22360417158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-22360417158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-22360417158Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.13e-42G2-like family protein