PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0001s0121.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family SBP
Protein Properties Length: 662aa    MW: 70694.5 Da    PI: 7.4629
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0001s0121.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1339.7e-42222299178
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           +Cq+egC+adls+ak+yhrrhkvCe hsk+p+v+++g++qrfCqqCsrfh l efDe+krsCrrrLa+hn+rrrk+q+
  Sphfalx0001s0121.1.p 222 MCQAEGCKADLSTAKHYHRRHKVCELHSKTPTVIAAGRTQRFCQQCSRFHLLGEFDEGKRSCRRRLADHNRRRRKQQP 299
                           6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-36215284IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.291220297IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-39221302IPR004333Transcription factor, SBP-box
PfamPF031103.3E-30223296IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MNSSANTNEH QGDSNWSTEN WDNTGAISSA LEHASRQYTT NRLEWEWDPM ILAQHPGSDG  60
PNEVGDGDHK SQITGGQMSS LRAYNNTIST GLPATFTQNA LGIFNPAGMW NYGALDGSGV  120
VLPPTGHLPN SLGSGIPGLA ASSGGHHENI QTAFDGQHHN QYLPSGMHKN HLVKREDVSD  180
GHTAPCIGLN LGVRTYFSAE DTAVGRVAKR HRAGSPGTQI PMCQAEGCKA DLSTAKHYHR  240
RHKVCELHSK TPTVIAAGRT QRFCQQCSRF HLLGEFDEGK RSCRRRLADH NRRRRKQQPS  300
AVSTGVGNSA EIASIRHGDD GDNGGVVSDA SYGRGGPGDN HRSLHQGMQL QTSSMAGQDS  360
QAFLSAMSLS PPVPLLVQHG KQEMSMMTGS SNHTQETAAY RKFLQGMSAG QSGPNLSLSS  420
LGEQLGLGHQ AGHQRQAAGT GSYGKIEPGV PWMHPLNSCS DLVQVVDRSS MNLHHLQTSH  480
HSANSASSTS PNSQSQEVQV FTPTNRNMLP LQASSQGDLT SPEWMLGSQG NSSNHYGPSS  540
AMSRSRHQLK GHQMLPLQNT STMRAGDGCS TSGGGNGCGS GTQDAGEHAP VMELLPHRIK  600
PTAESSSPDN NNNDNDQNKS NHSGNHTRAG VQSPELNYSG LQTLRSYGAG PSIYDLHHNL  660
M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-29214296184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024378733.10.0squamosa promoter-binding-like protein 14 isoform X2
TrEMBLA0A2K1KEN30.0A0A2K1KEN3_PHYPA; Uncharacterized protein
STRINGPP1S118_9V6.10.0(Physcomitrella patens)
STRINGPP1S252_40V6.11e-180(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.16e-41squamosa promoter binding protein-like 8