PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0000s0708.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family SBP
Protein Properties Length: 713aa    MW: 76509.4 Da    PI: 7.0904
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0000s0708.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.4e-41240316177
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                           +Cq+egC+adls+ak+yhrrhkvCe hskap+v++sg+ qrfCqqCsrfh l efD++krsCr+rLa+hn+rrrk+q
  Sphfalx0000s0708.1.p 240 MCQAEGCKADLSTAKHYHRRHKVCELHSKAPNVVASGHPQRFCQQCSRFHFLGEFDNGKRSCRKRLADHNRRRRKPQ 316
                           6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-35233302IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.06238315IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.28E-37239317IPR004333Transcription factor, SBP-box
PfamPF031107.7E-31241314IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 713 aa     Download sequence    Send to blast
MNSSANTSNL QGDPNWATVN WDQSGATGSL DQTACQYTAN RSEWLDCDPM ILAQHPGSGC  60
SSDCGDGDCK NHLTHAGTVS RLRAYNMLSS RLPPNFTQTS MGTFNSAAMW NYATVGTSGN  120
IPTPSAIHTV LGSSDIPGLA ATGRAGLHGD LQSSFHDQQH QEFYAGMQQD HHMVKREDIS  180
HCYTGLSMNG VRTQQNVTDG FGTPLGLNLG VRTYFSMDDN VVGQLVKRHR AGSPGSRVPM  240
CQAEGCKADL STAKHYHRRH KVCELHSKAP NVVASGHPQR FCQQCSRFHF LGEFDNGKRS  300
CRKRLADHNR RRRKPQPCAS TSETIAECMD MKGEEGDPSG SHATDQKSML LKKSGSPSSA  360
SLEESDEHPG SAGNKLQLHT SGATLGRAPG EDQHSTQSVM RMTSQPMRSS EAQSKFLPAM  420
STSPPAPPMP HNAEQHQLPM MTGTANHSQG ATVYQQYLQG FNPGQSGPCL SLSSLGGQGH  480
QPQSHGQPMP GQTYKGIDAP VPWMKIITSQ ASDLDQVVGR PGVLNLQHLT DSKIGQSPHQ  540
SITSAAANSN TRDPDAQVFP PNDQNLLPLQ ISSGDITGSE WTLRSLTGEQ NPGGEPNHFG  600
PSSHLLRLSG SGQLEGQQIL ETSTLWAAEG SNSGKSQSAQ NAQDGQTPME VLQQHNTGTG  660
SGRDHSTLTL GSAGGLNLKY HELHILRPFG TSSIYDSHQA PFSTRFSSDH MV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-29231314384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1297314KRSCRKRLADHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024390961.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390962.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390963.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390964.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390965.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390966.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390967.10.0squamosa promoter-binding-like protein 14
RefseqXP_024390968.10.0squamosa promoter-binding-like protein 14
TrEMBLA0A2K1JS040.0A0A2K1JS04_PHYPA; Uncharacterized protein
STRINGPP1S118_9V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.13e-49squamosa promoter binding protein-like 8