PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0000s0040.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 531aa    MW: 58955.4 Da    PI: 7.692
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0000s0040.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.5e-32298351255
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Sphfalx0000s0040.2.p 298 PRMRWTNSLHQQFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 351
                           9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-16295351IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28296351IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-24297351IPR006447Myb domain, plants
PfamPF002493.6E-8299350IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    Send to blast
MDLRFQASWN FTMQESFFTK SLNSSNEEAA HIIIPPAVAG PDLSLQICPP NSYNQLQQQQ  60
PPSFPSGLVL ASSNTPHEPM RYPDDFKHKM TPQDTLWLGD HQNLQPWVND AKLAAMPPGT  120
VQLNPISWNR SLARHAKAGQ HEKSHEHIHC GFDLWERQQK SANCNANSDM SYVSSPRKCY  180
DHEASFGTTA SRPDLCIANP SLDLQAASDH GTFSLPAEEK TRGVLHNLQS EYVKPTVAGG  240
LYHCLQSSSN SQSLLPNLMH ITAGDCTSIS SNLQETTRIL HCGFIMSKSP SKRSMRNPRM  300
RWTNSLHQQF VHAVELLGGH ERATPKSVLE LMNVKDLTLA HVKSHLQMYR TVKTTRQNDF  360
AESPHNNGRN YGEFLMAQGS LTNRGLETST FLPKSSNYYS TLGDAQATLL LMQNKKPSQQ  420
EASNLWHSPA LIPYSSNCIG LEQQLKATHT LSQDKGMENQ WMMGLTSPSI KQPPLQFSPP  480
LSEFVSSHTT NIIPKMPNLE FTLGTSGWSS TRGLDHGATD APQGLFLLKC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-17299353458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-17299353458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-17299353458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-17299353458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-17299353458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-17299353458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-17299353458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-17299353458Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.15e-34G2-like family protein