PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G183400.1.p
Common NameSb10g023400, SORBIDRAFT_10g023400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family HB-other
Protein Properties Length: 334aa    MW: 36885.7 Da    PI: 4.6882
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G183400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.65.6e-10261311353
                           --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
              Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                            R +++k qle+Le+++ +++ p+ +++  + + ++L+ + +  WF  rR 
  Sobic.010G183400.1.p 261 ARKRLKKVQLETLERVYLRSKRPTNAMISSIVQVTNLPRKTIVKWFEDRRE 311
                           58999********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.414256316IPR001356Homeobox domain
SuperFamilySSF466893.59E-10258313IPR009057Homeodomain-like
SMARTSM003894.0E-5258320IPR001356Homeobox domain
CDDcd000865.75E-9259310No hitNo description
Gene3DG3DSA:1.10.10.604.0E-9261311IPR009057Homeodomain-like
PfamPF000461.5E-7261311IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MATVLPLAAA SASASTSAAP RTCISGGLVP APFLGARVRL RIHSPPRGVA CALRRRPSKY  60
KTKIQSEENV VAAEDVMDDD DDEDGALEAL FKQLEEDLEN DDLSVDDDDD GISEEDMARF  120
EKELAEAIKG VSGVDESAGD SLMSSGDYGI DEQIDRSERP ELKTWQLRRL ARALKIGRRK  180
TSIKNLAGEL GLDRGLVIEM LRNPPPKLLL MSDSLPDEAP SKSEVKEIEP PSSTTDDEVD  240
TTEIKPELEL PVHVMSAEWS ARKRLKKVQL ETLERVYLRS KRPTNAMISS IVQVTNLPRK  300
TIVKWFEDRR EQDGVPDHRV AFKRSLSEIG SIS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1260268ARKRLKKVQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.80710.0leaf| shoot
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.010G183400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9654150.0EU965415.1 Zea mays clone 285861 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002437240.10.0protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLC5Z5L10.0C5Z5L1_SORBI; Uncharacterized protein
STRINGSb10g023400.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107003542
Representative plantOGRP69271618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.16e-59overexpressor of cationic peroxidase 3