PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G073600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family ARF
Protein Properties Length: 1054aa    MW: 116455 Da    PI: 6.6184
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G073600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.65e-23127228199
                           EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 
                           f+k+lt sd++++g +++p++ ae++       ++++++  +l+ +d++  sW++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F
  Sobic.010G073600.1.p 127 FCKTLTASDTSTHGGFSVPRRAAEKIfppldftMQPPAQ--ELIAKDLHDISWKFRHIYRGQPKRHLLTTGWSVFVSTKRLLAGDSVLF 213
                           99*****************************96555444..8*********************************************** PP

                           EE-SSSEE..EEEEE-S CS
                    B3  83 kldgrsefelvvkvfrk 99 
                              ++++ +l+++++r+
  Sobic.010G073600.1.p 214 I--RDEKSQLLLGIRRA 228
                           *..4567778***9997 PP

2Auxin_resp122.14e-40253335183
            Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                           aahaa+++s+F+++YnPras+seFv++++k++kal+++vs+GmRf+m feteds  rr++Gt++g+ dldp+rW+nS+Wr+L+
  Sobic.010G073600.1.p 253 AAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRMLFETEDSGVRRYMGTITGIGDLDPLRWKNSHWRNLQ 335
                           79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.84E-44117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.9E-41119241IPR015300DNA-binding pseudobarrel domain
CDDcd100175.45E-20126227No hitNo description
PROSITE profilePS5086312.266127229IPR003340B3 DNA binding domain
PfamPF023624.6E-21127228IPR003340B3 DNA binding domain
SMARTSM010191.4E-23127229IPR003340B3 DNA binding domain
PfamPF065078.4E-35253335IPR010525Auxin response factor
PfamPF023092.2E-99361025IPR033389AUX/IAA domain
PROSITE profilePS5174525.7479391032IPR000270PB1 domain
SuperFamilySSF542771.08E-89551018No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1054 aa     Download sequence    Send to blast
MKDQGSGGVT PSPAEGEKKP INSELWHACA GPLVSLPPVG SLVVYFPQGH SEQVAASMHK  60
ELDTIPSYPS LPSKLICKLL SLTLHADSET DEVYAQMTLQ PVNKYDRDAM LASELGLKQN  120
KQPTEFFCKT LTASDTSTHG GFSVPRRAAE KIFPPLDFTM QPPAQELIAK DLHDISWKFR  180
HIYRGQPKRH LLTTGWSVFV STKRLLAGDS VLFIRDEKSQ LLLGIRRASR PQPALSSSVL  240
SCDSMHIGIL AAAAHAAANS SPFTIFYNPR ASPSEFVIPL AKYNKALYTQ VSLGMRFRML  300
FETEDSGVRR YMGTITGIGD LDPLRWKNSH WRNLQVGWDE STASERRTRV SIWEIEPVAT  360
PFYICPPPFF RPKLPKQPGM PDDESEVESA FKRAMPWLAD DFALKDVQNA LFPGLSLVQW  420
MAMQQNPQML ATAAPAVQSQ YLTSNALGMQ DGIGSVSEDP TKRLSMQAQN IGLPNLQAGS  480
KVDHPAINSL AQHQQQPHHV LQQQQVQPLQ QSSAILQQQQ AQLLQQNAIH LQQQQEQLQR  540
QQSQPQQQLK ATACLQSSDQ HKLKEQQPSG GQAVSQAQLL NHILQPSSSQ LQQLGLPKSP  600
TQRPGLPGLT AMGSLQQSQL TQTSQLQQTA EYQQALLQSQ QPQLQQLSQS ELQLQLLQKI  660
QQQNLLSQLN PQHQSQLIQQ LSQKSQEILQ QQVLQHQVGG ADAMGQLKHL QQTPLNHTTG  720
SLTPQQLVRS HSALAESEEP SSSTAPSGSR ISPINSLSRA HQGSRNLPEM PATPQIEHLL  780
QEIQCKSDNR IKNDIQGSKE TVHAPNRHLA SDQLDASSAT SFCLDESPRE GFSFPPVCLD  840
NNVQVDPREN FLIAENVDTL MPDALLSRGM SSGKGICNLP TGQRDHRDVE NELSSAAFSS  900
QSFGVPDMSF KPGCSSDVAV ADGGMASQGL WNSQTQRMRT FTKVQKRGSV GRSIDITRYR  960
GYEDLRHDLA CMFGIQGQLE DPYRTDWKLV YVDHENDILL VGDDPWEEFV SCVKSIKILS  1020
SAEVQQMSLD GDLGCIPQTQ ACSASDDANA WRA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1661635645388Auxin response factor 5
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, culms, leaves and young panicles. {ECO:0000269|PubMed:17408882}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.010G073600.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277410.0KJ727741.1 Zea mays clone pUT5682 ARF transcription factor (ARF27) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021305688.10.0auxin response factor 16 isoform X1
SwissprotA3B9A00.0ARFP_ORYSJ; Auxin response factor 16
TrEMBLA0A194YIW10.0A0A194YIW1_SORBI; Auxin response factor
STRINGGRMZM2G160005_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90453338
Representative plantOGRP9033914
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Shen C, et al.
    OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.).
    Plant Cell Environ., 2013. 36(3): p. 607-20
    [PMID:22913536]
  2. Shen C, et al.
    OsARF16 is involved in cytokinin-mediated inhibition of phosphate transport and phosphate signaling in rice (Oryza sativa L.).
    PLoS ONE, 2014. 9(11): p. e112906
    [PMID:25386911]
  3. Shen C, et al.
    OsARF16, a transcription factor regulating auxin redistribution, is required for iron deficiency response in rice (Oryza sativa L.).
    Plant Sci., 2015. 231: p. 148-58
    [PMID:25576000]