PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sobic.009G212800.1.p | ||||||||
Common Name | Sb09g026830, SORBIDRAFT_09g026830 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 220aa MW: 22716.9 Da PI: 6.5159 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 99.7 | 1.8e-31 | 132 | 190 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++dp++v++tYeg+Hnh Sobic.009G212800.1.p 132 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCNVKKRVERDRDDPSYVVTTYEGTHNHV 190 59********************************************************5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.9E-34 | 118 | 192 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.09E-28 | 124 | 192 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.915 | 127 | 192 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.7E-36 | 132 | 191 | IPR003657 | WRKY domain |
Pfam | PF03106 | 4.9E-25 | 133 | 189 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0042742 | Biological Process | defense response to bacterium | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 220 aa Download sequence Send to blast |
MAAVGARPVL YHHPAPAGDA ASMSSYFSQG GSSTTSSSAS ASFSAALAPT TTTLAEQFDI 60 SEFLFDDAGV AGAPGVFADG SAPVVVSDAA AAAGGGAISA AAGSAAAAAE AVPERPRTER 120 IAFRTRSEIE ILDDGYKWRK YGKKSVKNSP NPRNYYRCST EGCNVKKRVE RDRDDPSYVV 180 TTYEGTHNHV SPSTVYYASQ DAASGRFFVA GTQPPGSLN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-26 | 122 | 193 | 7 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 1e-26 | 122 | 193 | 7 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sbi.12209 | 0.0 | ovary| root |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sobic.009G212800.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728363 | 0.0 | KJ728363.1 Zea mays clone pUT6645 WRKY transcription factor (WRKY82) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002440147.1 | 1e-158 | probable WRKY transcription factor 50 | ||||
Swissprot | Q93WU9 | 5e-44 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | C5YUJ2 | 1e-156 | C5YUJ2_SORBI; Uncharacterized protein | ||||
STRING | Sb09g026830.1 | 1e-157 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 | Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 2e-41 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sobic.009G212800.1.p |
Entrez Gene | 8061067 |
Publications ? help Back to Top | |||
---|---|---|---|
|