PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sobic.009G068900.1.p | ||||||||
Common Name | Sb09g005700, SORBIDRAFT_09g005700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 207aa MW: 22091.3 Da PI: 7.5454 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 97 | 1.3e-30 | 109 | 167 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K vk+s++pr+YYrC+s+gC vkk+ver+++dp++v++tY g Hnh Sobic.009G068900.1.p 109 LDDGFKWRKYGKKAVKNSPNPRNYYRCSSEGCGVKKRVERDRDDPRYVITTYDGVHNHA 167 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 9.0E-33 | 97 | 169 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.54E-28 | 101 | 169 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.996 | 104 | 169 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.2E-35 | 109 | 168 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.7E-24 | 110 | 166 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 207 aa Download sequence Send to blast |
MQMAASLGLN PEALFASYSS AYSSSSPFVS DYAASFPAAV DSATAFSAEL DDLHHFDYSP 60 APIFTAVGAG AGGDRNEKMM MWCEGGGDEK RLRSSGRIGF RTRSEVEILD DGFKWRKYGK 120 KAVKNSPNPR NYYRCSSEGC GVKKRVERDR DDPRYVITTY DGVHNHASPG AAAIIQYGGG 180 GGNSGFYSPP HSGSPSAASY SGSFVF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-28 | 94 | 169 | 2 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 2e-28 | 94 | 169 | 2 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sbi.49 | 0.0 | leaf| ovary |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sobic.009G068900.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT064457 | 0.0 | BT064457.1 Zea mays full-length cDNA clone ZM_BFc0171E09 mRNA, complete cds. | |||
GenBank | HQ858772 | 0.0 | HQ858772.1 Zea mays clone UT1758 WRKY transcription factor mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002440727.1 | 1e-150 | probable WRKY transcription factor 50 | ||||
TrEMBL | C5YU85 | 1e-149 | C5YU85_SORBI; Uncharacterized protein | ||||
STRING | Sb09g005700.1 | 1e-150 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 | Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 1e-41 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sobic.009G068900.1.p |
Entrez Gene | 8064208 |