PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sobic.008G168300.1.p | ||||||||
Common Name | Sb08g021370, SORBIDRAFT_08g021370 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 214aa MW: 23173.4 Da PI: 8.697 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 104.1 | 1.2e-32 | 108 | 164 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy++Il+RRq+Rak+e+e+kl k+rkpylheSRh+hAl+R+Rg gGrF Sobic.008G168300.1.p 108 EEPVYVNAKQYNAILRRRQSRAKAESERKL-VKGRKPYLHESRHQHALKRARGAGGRF 164 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 4.0E-35 | 106 | 167 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.53 | 107 | 167 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 5.5E-27 | 109 | 164 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.0E-23 | 110 | 132 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 112 | 132 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 2.0E-23 | 141 | 164 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 214 aa Download sequence Send to blast |
MTSVVQSVSG DHRAEDQHHQ KKQAEPGDQQ EAPVTSSDSQ PTVGTPSTDY VAPYAPHDMS 60 HAMGQYAYPN IDPYYGSLYA AYGGQPLMHP PLVGMHPAGL PLPTDAIEEP VYVNAKQYNA 120 ILRRRQSRAK AESERKLVKG RKPYLHESRH QHALKRARGA GGRFLNSKSD DKEENSDSSH 180 KEKQNGVAPN NGQPSTPPSP NGASSANQAG SRE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-21 | 107 | 171 | 1 | 65 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sbi.3363 | 0.0 | embryo| shoot |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sobic.008G168300.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU969919 | 0.0 | EU969919.1 Zea mays clone 337251 nuclear transcription factor Y subunit A-7 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002443549.1 | 1e-155 | nuclear transcription factor Y subunit A-7 | ||||
Swissprot | Q84JP1 | 9e-45 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | C5YRY5 | 1e-154 | C5YRY5_SORBI; Uncharacterized protein | ||||
STRING | Sb08g021370.1 | 1e-155 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6555 | 38 | 53 | Representative plant | OGRP680 | 16 | 72 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 7e-40 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sobic.008G168300.1.p |
Entrez Gene | 8070158 |
Publications ? help Back to Top | |||
---|---|---|---|
|