PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sobic.008G055800.1.p

Common Name

Sb08g004720, SORBIDRAFT_08g004720

Organism

Sorghum bicolor

Taxonomic ID

4558

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum

Family

MYB

Protein Properties

Length: 216aa MW: 23095.9 Da PI: 9.8274

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sobic.008G055800.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.6	1.2e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv ++k +G g+W++ ++ g+ R++k+c++rw +yl Sobic.008G055800.1.p 14 KGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	61.2	2.2e-19	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T+eEdel++++++ lG++ W++Ia +++ gRt++++k++w+++ Sobic.008G055800.1.p 67 RGNFTQEEDELIIKLHQILGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.7E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.922	9	61	IPR017930	Myb domain
SMART	SM00717	1.2E-13	13	63	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.73E-30	13	108	IPR009057	Homeodomain-like
Pfam	PF00249	2.1E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	1.92E-10	16	61	No hit	No description
PROSITE profile	PS51294	28.728	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	4.9E-29	65	117	IPR009057	Homeodomain-like
SMART	SM00717	4.8E-18	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	3.3E-17	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	6.81E-13	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 216 aa Download sequence Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLVAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF TQEEDELIIK LHQILGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLIARG 120 IDPRTHQPAS AGAVAPAPGA AASAAAPSSH RQHGDDKAAA VVRSSGCSSR DSSGDDDSTS 180 GSSVPHQHQL VVGGIDLNLS LSPPTSQPSS PAAAN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-30	14	116	7	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269\|PubMed:1840903}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves, seed pods and flowers. {ECO:0000269\|PubMed:1840903}.
Uniprot	TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Sobic.008G055800.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM156905	0.0	AM156905.1 Zea mays mRNA for transcription factor MYB8 (myb8 gene).
GenBank	HQ858692	0.0	HQ858692.1 Zea mays clone UT1148 ZmMYB8 transcription factor mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002442905.1	1e-157	myb-related protein Zm38
Swissprot	P81393	2e-89	MYB08_ANTMA; Myb-related protein 308
Swissprot	Q9SZP1	1e-88	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	C5YSS2	1e-156	C5YSS2_SORBI; Uncharacterized protein
STRING	Sb08g004720.1	1e-157	(Sorghum bicolor)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	9e-88	myb domain protein 4

Link Out ? help Back to Top
Phytozome	Sobic.008G055800.1.p
Entrez Gene	8079894

Publications ? help Back to Top
Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C Expression patterns of myb genes from Antirrhinum flowers. Plant Cell, 1991. 3(2): p. 115-25 [PMID:1840903] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]