PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sobic.004G306500.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 175aa MW: 19962.6 Da PI: 6.2956 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.1 | 1e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie+ rqvtfskRr g++KKAeELSvLCda+va+i+fsstgkl ++s Sobic.004G306500.2.p 9 KRIESAAARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLSQFAS 59 79*********************************************9986 PP | |||||||
2 | K-box | 56.8 | 9.9e-20 | 90 | 170 | 18 | 98 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + ++a+L++++ + +R++ Ge+Le Ls++eLqqLe++Le++l ++ ++K++ +leqi++l +k +l een++Lr+++ Sobic.004G306500.2.p 90 HSKYANLNEQLVEASLRLRQMRGEELEGLSVEELQQLEKNLETGLHRVLQTKDQQFLEQISDLERKSTQLAEENMQLRNQV 170 334555666666666889************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.623 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.0E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.81E-39 | 2 | 75 | No hit | No description |
PRINTS | PR00404 | 4.4E-25 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.35E-30 | 3 | 74 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.0E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.4E-25 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.4E-25 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.422 | 86 | 174 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.8E-17 | 92 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009266 | Biological Process | response to temperature stimulus | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MARERREIKR IESAAARQVT FSKRRRGLFK KAEELSVLCD ADVALIVFSS TGKLSQFASS 60 SMNEIIDKYN THSKNLGKAE EPSLDLNLEH SKYANLNEQL VEASLRLRQM RGEELEGLSV 120 EELQQLEKNL ETGLHRVLQT KDQQFLEQIS DLERKSTQLA EENMQLRNQV TSLL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-20 | 1 | 73 | 1 | 73 | MEF2C |
5f28_B | 2e-20 | 1 | 73 | 1 | 73 | MEF2C |
5f28_C | 2e-20 | 1 | 73 | 1 | 73 | MEF2C |
5f28_D | 2e-20 | 1 | 73 | 1 | 73 | MEF2C |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sbi.3886 | 0.0 | embryo| leaf| pollen |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the L1 cell layer of the embryo 2 days after pollination. {ECO:0000269|PubMed:15682279}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in palea and stamen primordia. {ECO:0000269|PubMed:15682279}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. May be required for spikelet (rice flower) development. {ECO:0000269|PubMed:15682279}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00272 | DAP | Transfer from AT2G22540 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sobic.004G306500.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ430633 | 0.0 | AJ430633.1 Zea mays mRNA for putative MADS-domain transcription factor (m19 gene). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021314301.1 | 1e-119 | MADS-box transcription factor 22 isoform X2 | ||||
Swissprot | Q9XJ66 | 1e-111 | MAD22_ORYSJ; MADS-box transcription factor 22 | ||||
TrEMBL | A0A194YTJ1 | 1e-120 | A0A194YTJ1_SORBI; Uncharacterized protein | ||||
STRING | Sb04g033930.1 | 1e-118 | (Sorghum bicolor) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 2e-59 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sobic.004G306500.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|