PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G302400.1.p
Common NameSb04g033570, SORBIDRAFT_04g033570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family NAC
Protein Properties Length: 348aa    MW: 39245.1 Da    PI: 6.5098
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G302400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.44.6e-5671361129
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkat 86 
                           +ppGfrFhPtdeelv++yL+kkv+++k++l +vik+vd+yk+ePwdL++  k+   e++ewyfFs++dkky+tg+r+nrat++g+Wkat
  Sobic.004G302400.1.p   7 VPPGFRFHPTDEELVDYYLRKKVASNKIDL-DVIKDVDLYKIEPWDLQEkcKIGMeEQNEWYFFSHKDKKYPTGSRTNRATTAGFWKAT 94 
                           69****************************.9***************952433333556****************************** PP

                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                           g+dk++++ k+ lvg++ktLvfy+grap+g+k+dW+mheyrle
  Sobic.004G302400.1.p  95 GRDKPIYT-KSCLVGMRKTLVFYRGRAPNGQKSDWIMHEYRLE 136
                           ********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-615156IPR003441NAC domain
PROSITE profilePS5100560.1977156IPR003441NAC domain
PfamPF023651.1E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MDTFSHVPPG FRFHPTDEEL VDYYLRKKVA SNKIDLDVIK DVDLYKIEPW DLQEKCKIGM  60
EEQNEWYFFS HKDKKYPTGS RTNRATTAGF WKATGRDKPI YTKSCLVGMR KTLVFYRGRA  120
PNGQKSDWIM HEYRLETTEN GTAPEEGWVV CRVFKKRVAT VRRMADGAPW FDDHVAGGGF  180
MPDLIGSPRQ LMHHHHHPNA VYSGGQQQLY HCKPELEYHH LLPSQDAFLQ QLPQLVESPK  240
PPPAYIAAAQ GSCSLQLQSP DEATGYTTQQ PALMMEAAAY MDDSVTDWRV LDKFVASQLF  300
SHGDGTAKEA GYSSPAQVFQ AENKQPEEAL DYASTSASGG GEANMWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-51715717166NO APICAL MERISTEM PROTEIN
1ut4_B6e-51715717166NO APICAL MERISTEM PROTEIN
1ut7_A6e-51715717166NO APICAL MERISTEM PROTEIN
1ut7_B6e-51715717166NO APICAL MERISTEM PROTEIN
3swm_A8e-51715720169NAC domain-containing protein 19
3swm_B8e-51715720169NAC domain-containing protein 19
3swm_C8e-51715720169NAC domain-containing protein 19
3swm_D8e-51715720169NAC domain-containing protein 19
3swp_A8e-51715720169NAC domain-containing protein 19
3swp_B8e-51715720169NAC domain-containing protein 19
3swp_C8e-51715720169NAC domain-containing protein 19
3swp_D8e-51715720169NAC domain-containing protein 19
4dul_A6e-51715717166NAC domain-containing protein 19
4dul_B6e-51715717166NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Expressed in root, shoot and hypocotyl vascular elements, columella root caps, epidermal and cortex root cells and root-hypocotyl junctions. Observed predominantly in root imature xylem vessels (PubMed:18445131). Present in root developing xylems (PubMed:16103214, PubMed:17565617). Specifically expressed in vessels in the secondary xylem of the root-hypocotyl region, and in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.004G302400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0750930.0KT075093.1 Panicum virgatum secondary wall NAC master switch (SWN8B) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021314802.10.0NAC domain-containing protein 7 isoform X1
RefseqXP_021314803.10.0NAC domain-containing protein 7 isoform X1
SwissprotQ9FWX21e-118NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A194YTG60.0A0A194YTG6_SORBI; Uncharacterized protein
STRINGSb04g033570.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-121NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]