PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sobic.004G281000.1.p | ||||||||
Common Name | Sb04g031750, SORBIDRAFT_04g031750 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 256aa MW: 29030 Da PI: 8.9306 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 100.1 | 8.8e-32 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ Sobic.004G281000.1.p 9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58 79**********************************************95 PP | |||||||
2 | K-box | 104.6 | 1.3e-34 | 78 | 171 | 6 | 99 |
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 +++ + ++++s++qe++kL+++ e Lqr+qRhllGedL++Ls+keLqqLe+qLe +l++ R++K++l++eq+eel++ke+ l e n++L Sobic.004G281000.1.p 78 DSNGALSETQSWYQEMSKLRAKFEALQRTQRHLLGEDLGPLSVKELQQLEKQLECALSQARQRKTQLMMEQVEELRRKERHLGEMNRQL 166 344466788******************************************************************************** PP K-box 95 rkkle 99 ++kle Sobic.004G281000.1.p 167 KHKLE 171 ***97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.571 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.8E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.69E-46 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 3.66E-33 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.6E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.1E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.6E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.6E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.2E-30 | 85 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 17.858 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009553 | Biological Process | embryo sac development | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010094 | Biological Process | specification of carpel identity | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048455 | Biological Process | stamen formation | ||||
GO:0048459 | Biological Process | floral whorl structural organization | ||||
GO:0048509 | Biological Process | regulation of meristem development | ||||
GO:0048833 | Biological Process | specification of floral organ number | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0080112 | Biological Process | seed growth | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 256 aa Download sequence Send to blast |
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSA 60 GITKTLERYQ HCCYNAQDSN GALSETQSWY QEMSKLRAKF EALQRTQRHL LGEDLGPLSV 120 KELQQLEKQL ECALSQARQR KTQLMMEQVE ELRRKERHLG EMNRQLKHKL EAEGSSNYRT 180 LQHAAAWPAP GGTIVEHDGA TYHVHPPAHS VAIDCEPTLQ IGYPHHQFLP SDQAANNIPR 240 NAPGGENNFM LGWVL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ox0_A | 2e-22 | 79 | 174 | 10 | 104 | Developmental protein SEPALLATA 3 |
4ox0_B | 2e-22 | 79 | 174 | 10 | 104 | Developmental protein SEPALLATA 3 |
4ox0_C | 2e-22 | 79 | 174 | 10 | 104 | Developmental protein SEPALLATA 3 |
4ox0_D | 2e-22 | 79 | 174 | 10 | 104 | Developmental protein SEPALLATA 3 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sbi.13594 | 1e-82 | ovary| panicle |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during ovule development in the inner and outer integuments. Not detected in young panicles. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:19820190}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the floral meristem. Highly expressed in lodicules. Expressed in palea and pistil. Weakly expressed in carpels, empty glumes and stamens. Not detected in lemmas. {ECO:0000269|PubMed:10444103, ECO:0000269|PubMed:19820190}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269|PubMed:19820190, ECO:0000269|Ref.8}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00315 | DAP | Transfer from AT2G45650 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sobic.004G281000.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT087751 | 0.0 | BT087751.1 Zea mays full-length cDNA clone ZM_BFb0184N10 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002454472.1 | 0.0 | MADS-box transcription factor 6 | ||||
Swissprot | Q6EU39 | 1e-149 | MADS6_ORYSJ; MADS-box transcription factor 6 | ||||
TrEMBL | C5Y0X9 | 0.0 | C5Y0X9_SORBI; Uncharacterized protein | ||||
STRING | Sb04g031750.1 | 0.0 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4187 | 35 | 66 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45650.1 | 1e-100 | AGAMOUS-like 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sobic.004G281000.1.p |
Entrez Gene | 8076029 |