PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G305000.1.p
Common NameSb03g035350, SORBIDRAFT_03g035350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family TCP
Protein Properties Length: 290aa    MW: 31151.7 Da    PI: 7.3876
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G305000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP94.91.6e-2952122373
                   TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                           g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl++a ++i++l+ ++++++++ 
  Sobic.003G305000.1.p  52 GGKDRHSKVKTVKGLRDRRVRLSVPTAIQLYDLQDRLGLNQPSKVVDWLLNAARHEIDKLPPLQFPPHQDL 122
                           78*************************************************************99999655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136929.95153111IPR017887Transcription factor TCP subgroup
PfamPF036346.0E-2753114IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MIRGGNNQEA ADVEELLAHH QQNKQHAAVA TSSRQWSAQT ESRIVRVSRV FGGKDRHSKV  60
KTVKGLRDRR VRLSVPTAIQ LYDLQDRLGL NQPSKVVDWL LNAARHEIDK LPPLQFPPHQ  120
DLMVGHLTPH MPLVHEETKF GHIAAAAALA SDGGGAKVSQ QGDVDVDVDG TGGAHHLVGR  180
FPGGGYYHRF MELNSALGMV SSAMAPYSNY TGEAWNNSSG GMHDGGAGGS PQVVAAAHHS  240
PFPSLLSLAP RPHQLAFYSS EGDQQFQVEN LGSQSLSLSS ARAYHDQAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-2058112155Putative transcription factor PCF6
5zkt_B2e-2058112155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00008PBMTransfer from 496250Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.003G305000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9702170.0EU970217.1 Zea mays clone 342355 TCP family transcription factor containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458537.10.0uncharacterized protein LOC8072107
RefseqXP_021311115.10.0uncharacterized protein LOC8072107
RefseqXP_021311116.10.0uncharacterized protein LOC8072107
RefseqXP_021311117.10.0uncharacterized protein LOC8072107
TrEMBLC5XKV10.0C5XKV1_SORBI; Uncharacterized protein
STRINGSb03g035350.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.12e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5