PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sobic.003G157300.3.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 126aa MW: 13611.4 Da PI: 10.4074 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 61.9 | 7.8e-20 | 22 | 56 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C++t+Tp+WR+gp g+++LCnaCG++yrkk++ Sobic.003G157300.3.p 22 CVECRATTTPMWRSGPTGPRSLCNACGIRYRKKRR 56 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 13.257 | 16 | 52 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 2.1E-15 | 16 | 70 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.24E-13 | 18 | 57 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 2.7E-16 | 20 | 57 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.35E-13 | 21 | 57 | No hit | No description |
Pfam | PF00320 | 1.4E-17 | 22 | 56 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 22 | 47 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MGSADRSKID GIVVAEKGAR SCVECRATTT PMWRSGPTGP RSLCNACGIR YRKKRRQELG 60 LDHKQQQQQN NGEAKAEVKD SSSNSSSSGS SNLQVVQKRR LLMGVEEAAF LLMTLSSPTF 120 TLLHG* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sbi.4968 | 0.0 | leaf |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sobic.003G157300.3.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT040389 | 1e-141 | BT040389.1 Zea mays full-length cDNA clone ZM_BFc0088I05 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021310786.1 | 8e-89 | GATA transcription factor 23-like | ||||
TrEMBL | A0A1B6Q3G9 | 2e-87 | A0A1B6Q3G9_SORBI; Uncharacterized protein | ||||
STRING | Sb03g013700.1 | 3e-88 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6721 | 28 | 54 | Representative plant | OGRP68 | 17 | 287 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 1e-19 | GATA transcription factor 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sobic.003G157300.3.p |