PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G101100.1.p
Common NameSb03g008470, SORBIDRAFT_03g008470
Organism
Sorghum bicolor
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family NAC
Protein Properties Length: 144aa    MW: 16677.1 Da    PI: 9.679
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G101100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM130.99.7e-41201431120
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lp Gf+F+P+d e+v++++++kv++++ ++ ++i evd++k+ePwdL k++k +ekewyfF ++d+ky+tg r n atk+gyWkatgkd
  Sobic.003G101100.1.p  20 LPIGFHFDPSDFEIVNHFIRNKVRNRDYTC-TAIGEVDLNKTEPWDLLKEAKMGEKEWYFFYQKDRKYPTGLRVNWATKAGYWKATGKD 107
                           699************************999.88**************9889999*********************************** PP

                   NAM  90 kevlsk.kgel.....vglkktLvfykgrapkgektd 120
                           k+v++  k  +     vg+kktLvfyk rap+g kt+
  Sobic.003G101100.1.p 108 KKVYKPsK-GEevvllVGMKKTLVFYKSRAPRGDKTN 143
                           *****852.3346888*******************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-4210143IPR003441NAC domain
PROSITE profilePS5100539.65420143IPR003441NAC domain
PfamPF023651.3E-1721135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MADQQQQQEM NDVCASGLNL PIGFHFDPSD FEIVNHFIRN KVRNRDYTCT AIGEVDLNKT  60
EPWDLLKEAK MGEKEWYFFY QKDRKYPTGL RVNWATKAGY WKATGKDKKV YKPSKGEEVV  120
LLVGMKKTLV FYKSRAPRGD KTN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-341814313132Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Age-dependent accumulation. First observed in young seedlings in cotyledons and regularly in the tip regions of very young leaves. Accumulates strongly in older leaf parts at the senescence onset. In flowers, present in mature organs such as old sepals, petals, old stamens, mature anthers, and pollen grains. Confined to floral organ abscission zone of mature flowers. Also observed in roots. {ECO:0000269|PubMed:21303842}.
UniprotTISSUE SPECIFICITY: Mostly expressed in root cortex, phloem, atrichoblast and quiescent center (QC), and, to a lower extent, in root endodermis, xylem, pericycle, columella and lateral root cap (LRC) (PubMed:16581911). Expressed in roots, cotyledons, very young leaves, senescing leaves, mature flowers and pollen (PubMed:21303842). {ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:21303842}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:21303842}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.003G101100.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269|PubMed:21303842}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439487.16e-70NAC domain-containing protein 100
SwissprotQ9LJW31e-50NAC59_ARATH; NAC domain-containing protein 59
TrEMBLC5XEY01e-103C5XEY0_SORBI; Uncharacterized protein
STRINGSb03g008470.11e-104(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29035.14e-53NAC domain containing protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Manacorda CA, et al.
    Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes.
    Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98
    [PMID:23945002]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]