PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sobic.003G076600.1.p

Common Name

Sb03g006450, SORBIDRAFT_03g006450

Organism

Sorghum bicolor

Taxonomic ID

4558

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum

Family

MYB_related

Protein Properties

Length: 141aa MW: 15655.6 Da PI: 10.5796

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sobic.003G076600.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.5	9.5e-16	36	80	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE++l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky Sobic.003G076600.1.p 36 PWTEEEHKLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 80 8*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.437	29	85	IPR017930	Myb domain
SuperFamily	SSF46689	3.93E-18	31	86	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	7.8E-17	33	83	IPR006447	Myb domain, plants
SMART	SM00717	2.8E-12	33	83	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.1E-12	35	79	IPR009057	Homeodomain-like
Pfam	PF00249	3.4E-13	36	80	IPR001005	SANT/Myb domain
CDD	cd00167	1.09E-12	36	81	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 141 aa Download sequence Send to blast
MENGEVRFLP ICSCGGSSGG NAFARPEQGR KKRVRPWTEE EHKLFLLGLK KYGKGDWRNI 60 SRNFVQTRTP TQVASHAQKY FIRLNKKRSS IRDTTTVNLT DDQPTSPSQS SLITDQFSAL 120 ALATDVNQNS RANSPSIELA *

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Sbi.7738	1e-62	root

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269\|PubMed:11937495}.

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269\|PubMed:11937495, ECO:0000269\|PubMed:9118809}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Sobic.003G076600.1.p

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002455218.1	1e-101	transcription factor DIVARICATA
Swissprot	Q8S9H7	3e-37	DIV_ANTMA; Transcription factor DIVARICATA
TrEMBL	C5XQ43	1e-100	C5XQ43_SORBI; Uncharacterized protein
STRING	Sb03g006450.1	1e-101	(Sorghum bicolor)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP7886	33	48
Representative plant	OGRP275	17	122

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G58900.1	1e-26	Homeodomain-like transcriptional regulator

Link Out ? help Back to Top
Phytozome	Sobic.003G076600.1.p
Entrez Gene	8073322

Publications ? help Back to Top
Galego L,Almeida J Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers. Genes Dev., 2002. 16(7): p. 880-91 [PMID:11937495] Almeida J,Rocheta M,Galego L Genetic control of flower shape in Antirrhinum majus. Development, 1997. 124(7): p. 1387-92 [PMID:9118809]