PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G287400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Nin-like
Protein Properties Length: 858aa    MW: 94014.6 Da    PI: 7.0174
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G287400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.47e-29538589152
                RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           aek++sl++l++yF++++kdAA++Lgvc+T+LKriCRq+GI RWP+Rkik++
  Sobic.002G287400.1.p 538 AEKTVSLQVLRQYFAGSLKDAARSLGVCPTTLKRICRQHGITRWPSRKIKKV 589
                           5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.803528609IPR003035RWP-RK domain
PfamPF020422.4E-25541589IPR003035RWP-RK domain
SuperFamilySSF542772.16E-22748846No hitNo description
Gene3DG3DSA:3.10.20.2406.5E-26756840No hitNo description
SMARTSM006661.2E-21759842IPR000270PB1 domain
PROSITE profilePS5174522.673759842IPR000270PB1 domain
CDDcd064076.22E-40760840No hitNo description
PfamPF005643.5E-16760840IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 858 aa     Download sequence    Send to blast
MEEGGDPQPQ LPSISVARTT SEGAGAAVDL DLLEQLLSGD NGWLEVVSRS PNSVAFSPPS  60
AFFSADATAT TVTTTTAAPT ANASWWIQTG GASPSSVRER FSQALSYIRD TQSDGDVLVQ  120
LWVPVNRDDG KLVLTTSGQP FTLDHRSDSL IRFRDVSTKY QFSADVNSGD TPGLPGRVFI  180
GRLPEWSPDI RYFTSYEYPR VRDAQYLDVH GTMGLPVFEK GSYNCLGVIE LIMTRQKLNF  240
TSELNTICSA LQAVNLRSTE VSSIPRIKFS TASYKDALPE ILEVLRAACL THKLPLAQTW  300
VTCAQQGKRG SRHSDENYRY CISTIDEACF VNEAEMRGFH EACSEHHLLR GEGVAGKAFT  360
TNQPCFLPDI GSSTKLEYPL SHHAKIFKLK GAVAIRLRCT RTGTADFVLE FFLPTDCEAL  420
EEQKTVLDSL SSTMRGVCQT LRVVTDREME DEAVLEMNEL NSFTPQGKDK VEELSFGGKS  480
ADRRGEASWT SLAGTSQQES ELAALRMHGM FSPGGQGPSL SGVQATAEGS KAKRRTKAEK  540
TVSLQVLRQY FAGSLKDAAR SLGVCPTTLK RICRQHGITR WPSRKIKKVD HSLRKLQQII  600
DSVHGAETAF QLNTLYKDLT NTSISSDNNL SGSVMVPPTN QSNLTDFNKH QPHKSSSNVP  660
STSHSHSSCS HSSKSSPSCS GGATKHAQQG IIDLIKSKNP VKDSSIQTLQ TENPSLYEHF  720
SVHEAPIDLL QDVTEKANGG HHSSPSPSSH NPKQNTDANM RVKATFGSEK VRFRLNPECN  780
FQELKHEIAK RLSIVDTNPL VLKYLDDDSE WVLMTCDADL QECLHVYKLA DIQTIKISVH  840
LAISPATRVT TGHTGLS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.002G287400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9712710.0EU971271.1 Zea mays clone 360961 NIN-like protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021309543.10.0protein NLP1
RefseqXP_021309544.10.0protein NLP1
TrEMBLA0A1B6QDX70.0A0A1B6QDX7_SORBI; Uncharacterized protein
STRINGGRMZM2G053298_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55543852
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein