PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G200300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family NAC
Protein Properties Length: 404aa    MW: 45040.5 Da    PI: 7.9369
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G200300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.98.2e-53141411128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           l pGfrFhPtdeel+++yLk+k+++k++++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d
  Sobic.002G200300.1.p  14 LLPGFRFHPTDEELISFYLKRKIQQKPVSI-ELIRQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTD 101
                           579*************************99.89***************9888999********************************** PP

                   NAM  90 kevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                           ++v+s+ +++ +glkk+Lvfykgra +g ktdW+mheyrl
  Sobic.002G200300.1.p 102 RPVYSSeGTKCIGLKKSLVFYKGRAARGIKTDWMMHEYRL 141
                           *****956667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-5812172IPR003441NAC domain
PROSITE profilePS5100557.69414172IPR003441NAC domain
PfamPF023654.5E-2616141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MDERADMDKS DEVLLPGFRF HPTDEELISF YLKRKIQQKP VSIELIRQLD IYKYDPWDLP  60
KLASTGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPVYSSEGT KCIGLKKSLV  120
FYKGRAARGI KTDWMMHEYR LPSLNDPSRP KTPKDKNIPA NDAWAICRIF KKPNSVAQRV  180
LSHSWGPQSI TTTEPELLSA LQSIQASHFA LESSTCSANR FNSQQCLQEN LNNSQDGSPC  240
KVITFNRSLS LPSEKDIHSS YVSKKDIHSS SVILPLEIQS QQKSSDATSV LLSMAPGILN  300
SMNEAIPNTE FGLLEPSNGY IVDWATDSSG GIGNSDGDTY TRKSGNGYSS GNECGIPRKI  360
KFPFNLGVGS PDDWTSNMPC DSLPCSPHPA EMSNSNSTEK YYA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-531417817171NO APICAL MERISTEM PROTEIN
1ut4_B2e-531417817171NO APICAL MERISTEM PROTEIN
1ut7_A2e-531417817171NO APICAL MERISTEM PROTEIN
1ut7_B2e-531417817171NO APICAL MERISTEM PROTEIN
4dul_A2e-531417817171NAC domain-containing protein 19
4dul_B2e-531417817171NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed at globular stage onward in the COL progenitors after the first division of the hypophyseal cell. Later observed in these cells and their descendants, mostly in direct daughter cells. Also detected in the Epi/LRC stem cells and daughters, and is retained in maturing LRC layers. Present in elongated stem cells that are about to divide. {ECO:0000269|PubMed:19081078}.
UniprotTISSUE SPECIFICITY: Expressed in root cap stem cells and their immediate daughters. {ECO:0000269|PubMed:19081078}.
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.002G200300.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021307991.10.0protein FEZ
SwissprotQ9ZVH02e-97FEZ_ARATH; Protein FEZ
TrEMBLA0A1W0W5620.0A0A1W0W562_SORBI; Uncharacterized protein
STRINGSb02g024593.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-100NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]