PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G496600.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family STAT
Protein Properties Length: 622aa    MW: 69012 Da    PI: 6.1733
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G496600.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT186.43.4e-581452621118
                  STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveks.ddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfe 88 
                           l+vvl+na+g pv kd+evvasL+yad+g+vv+ks dd+e+pLLi++dG+e+++  rpl+++rGra+fklkisqLsskcdn+Lfri+f+
  Sobic.001G496600.4.p 145 LEVVLTNAFGAPV-KDKEVVASLVYADDGTVVAKSrDDSEPPLLITCDGLEYAAITRPLPIIRGRALFKLKISQLSSKCDNKLFRIQFS 232
                           79**********9.*********************9***************************************************** PP

                  STAT  89 ipklkkypfleavskpirCisrsrntrsss 118
                           ++++++ypflea+skpirCisrsr++++++
  Sobic.001G496600.4.p 233 TLHMQRYPFLEAYSKPIRCISRSRTVHPLG 262
                           ************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.505.106.1E-4514594IPR000980SH2 domain
SuperFamilySSF555501.57E-7517601IPR000980SH2 domain
PROSITE profilePS500019.752523621IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MRLHREAPGP ASSYPWTHTT KLSSTSQCPL EKWFHIGCEV TENVMRLHLD GSLTAEASVC  60
SLFDGPESQD DANQISLVGS DGKLEGYIYN IEVSSVLGNI KEQYTKNPPF KLSIDYSCSD  120
GIEEGGDGIW NIVGGKASCR RNFILEVVLT NAFGAPVKDK EVVASLVYAD DGTVVAKSRD  180
DSEPPLLITC DGLEYAAITR PLPIIRGRAL FKLKISQLSS KCDNKLFRIQ FSTLHMQRYP  240
FLEAYSKPIR CISRSRTVHP LGPGKRASSA TVDETDLLNN GQGFVSADKV NGREHSMCLD  300
APMFPKIEGG MVKVVEAHKM VSQNKNARKV VVSKEAQNVM RTDSSTSNYD SFDSGSSWSG  360
SDGDDGIETF SDAVVFRYCL DSTYDRLKFL RGAAPTVNKD DLVKLADQVS LYSGCSHHRN  420
QILMSKRLLR EGADTWNMIS KNNERALWSS AIPEIITKFT NIAHSVSRGL SEQDVEVLRG  480
IAGCGEDIGR DEFDRLWYWL YPVAVSLSRE NIKKLWDCTT PRWIEGLITI EEAENALRSS  540
RELLKEPGTF VLRFPTTRSW PHPDAGCLVV TYIGSDNSIH HRLLSLDSSD ASAENLQDLL  600
LQEPELSQLG RVDRLPTAIR R*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.117480.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G496600.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021307365.10.0uncharacterized protein LOC8059855 isoform X1
TrEMBLA0A1Z5SB990.0A0A1Z5SB99_SORBI; Uncharacterized protein
STRINGGRMZM2G453001_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.11e-147SH2 domain protein B