PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G496600.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family STAT
Protein Properties Length: 641aa    MW: 70601.7 Da    PI: 5.7226
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G496600.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT186.43.6e-581642811118
                  STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveks.ddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfe 88 
                           l+vvl+na+g pv kd+evvasL+yad+g+vv+ks dd+e+pLLi++dG+e+++  rpl+++rGra+fklkisqLsskcdn+Lfri+f+
  Sobic.001G496600.3.p 164 LEVVLTNAFGAPV-KDKEVVASLVYADDGTVVAKSrDDSEPPLLITCDGLEYAAITRPLPIIRGRALFKLKISQLSSKCDNKLFRIQFS 251
                           79**********9.*********************9***************************************************** PP

                  STAT  89 ipklkkypfleavskpirCisrsrntrsss 118
                           ++++++ypflea+skpirCisrsr++++++
  Sobic.001G496600.3.p 252 TLHMQRYPFLEAYSKPIRCISRSRTVHPLG 281
                           ************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.505.106.4E-4533613IPR000980SH2 domain
SuperFamilySSF555501.57E-7536620IPR000980SH2 domain
PROSITE profilePS500019.752542640IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 641 aa     Download sequence    Send to blast
MAAPESECGG TDGYRDLRGV RVELDPGTAR VGGGGGFAVS FWLYLSSSAR PSSVILRQVT  60
ENVMRLHLDG SLTAEASVCS LFDGPESQDD ANQISLVGSD GKLEGYIYNI EVSSVLGNIK  120
EQYTKNPPFK LSIDYSCSDG IEEGGDGIWN IVGGKASCRR NFILEVVLTN AFGAPVKDKE  180
VVASLVYADD GTVVAKSRDD SEPPLLITCD GLEYAAITRP LPIIRGRALF KLKISQLSSK  240
CDNKLFRIQF STLHMQRYPF LEAYSKPIRC ISRSRTVHPL GPGKRASSAT VDETDLLNNG  300
QGFVSADKVN GREHSMCLDA PMFPKIEGGM VKVVEAHKMV SQNKNARKVV VSKEAQNVMR  360
TDSSTSNYDS FDSGSSWSGS DGDDGIETFS DAVVFRYCLD STYDRLKFLR GAAPTVNKDD  420
LVKLADQVSL YSGCSHHRNQ ILMSKRLLRE GADTWNMISK NNERALWSSA IPEIITKFTN  480
IAHSVSRGLS EQDVEVLRGI AGCGEDIGRD EFDRLWYWLY PVAVSLSREN IKKLWDCTTP  540
RWIEGLITIE EAENALRSSR ELLKEPGTFV LRFPTTRSWP HPDAGCLVVT YIGSDNSIHH  600
RLLSLDSSDA SAENLQDLLL QEPELSQLGR VDRLPTAIRR *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.117480.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G496600.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021307365.10.0uncharacterized protein LOC8059855 isoform X1
TrEMBLA0A1Z5SB910.0A0A1Z5SB91_SORBI; Uncharacterized protein
STRINGGRMZM2G453001_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.11e-130SH2 domain protein B