PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G496600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family STAT
Protein Properties Length: 705aa    MW: 77676.9 Da    PI: 6.0613
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G496600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT186.14.2e-582283451118
                  STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveks.ddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfe 88 
                           l+vvl+na+g pv kd+evvasL+yad+g+vv+ks dd+e+pLLi++dG+e+++  rpl+++rGra+fklkisqLsskcdn+Lfri+f+
  Sobic.001G496600.1.p 228 LEVVLTNAFGAPV-KDKEVVASLVYADDGTVVAKSrDDSEPPLLITCDGLEYAAITRPLPIIRGRALFKLKISQLSSKCDNKLFRIQFS 315
                           79**********9.*********************9***************************************************** PP

                  STAT  89 ipklkkypfleavskpirCisrsrntrsss 118
                           ++++++ypflea+skpirCisrsr++++++
  Sobic.001G496600.1.p 316 TLHMQRYPFLEAYSKPIRCISRSRTVHPLG 345
                           ************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2004.5E-521160IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF498996.51E-532147IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.107.3E-4597677IPR000980SH2 domain
SuperFamilySSF555501.9E-7600684IPR000980SH2 domain
PROSITE profilePS500019.752606704IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 705 aa     Download sequence    Send to blast
MAAPESECGG TDGYRDLRGV RVELDPGTAR VGGGGGFAVS FWLYLSSSAR PSSVILRQIA  60
AGDDNKLPFL ALGEGNKLLL FPLMRLHREA PGPASSYPWT HTTKLSSTSQ CPLEKWFHIG  120
CEVTENVMRL HLDGSLTAEA SVCSLFDGPE SQDDANQISL VGSDGKLEGY IYNIEVSSVL  180
GNIKEQYTKN PPFKLSIDYS CSDGIEEGGD GIWNIVGGKA SCRRNFILEV VLTNAFGAPV  240
KDKEVVASLV YADDGTVVAK SRDDSEPPLL ITCDGLEYAA ITRPLPIIRG RALFKLKISQ  300
LSSKCDNKLF RIQFSTLHMQ RYPFLEAYSK PIRCISRSRT VHPLGPGKRA SSATVDETDL  360
LNNGQGFVSA DKVNGREHSM CLDAPMFPKI EGGMVKVVEA HKMVSQNKNA RKVVVSKEAQ  420
NVMRTDSSTS NYDSFDSGSS WSGSDGDDGI ETFSDAVVFR YCLDSTYDRL KFLRGAAPTV  480
NKDDLVKLAD QVSLYSGCSH HRNQILMSKR LLREGADTWN MISKNNERAL WSSAIPEIIT  540
KFTNIAHSVS RGLSEQDVEV LRGIAGCGED IGRDEFDRLW YWLYPVAVSL SRENIKKLWD  600
CTTPRWIEGL ITIEEAENAL RSSRELLKEP GTFVLRFPTT RSWPHPDAGC LVVTYIGSDN  660
SIHHRLLSLD SSDASAENLQ DLLLQEPELS QLGRVDRLPT AIRR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.117480.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G496600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021307365.10.0uncharacterized protein LOC8059855 isoform X1
TrEMBLA0A1B6QQG00.0A0A1B6QQG0_SORBI; Uncharacterized protein
STRINGGRMZM2G453001_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75473135
Representative plantOGRP59411618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.11e-161SH2 domain protein B