PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sobic.001G023900.1.p | ||||||||
Common Name | Sb01g002270, SORBIDRAFT_01g002270 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 158aa MW: 17143.5 Da PI: 10.629 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 56.7 | 3.3e-18 | 28 | 62 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+ttkTplWR gp g+ +LCnaCG++yrkk++ Sobic.001G023900.1.p 28 CTECHTTKTPLWRGGPCGPMSLCNACGIRYRKKRR 62 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 3.18E-13 | 22 | 61 | No hit | No description |
PROSITE profile | PS50114 | 12.558 | 22 | 58 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 3.9E-15 | 22 | 75 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.5E-14 | 23 | 62 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 9.95E-14 | 27 | 62 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 28 | 53 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 5.5E-16 | 28 | 62 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005667 | Cellular Component | transcription factor complex | ||||
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MDSSAEKQGS GTLDPDERPP ASGETKACTE CHTTKTPLWR GGPCGPMSLC NACGIRYRKK 60 RREAMGLDSS SKAGGGTEQQ QQRKKKATAA AAAAAASKRE RERSKEADEV TVELRAVGFG 120 KEVVLKQRRR MRRRRRLGEE ERAAFLLMAL SSGVVYA* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 126 | 132 | QRRRMRR |
2 | 128 | 133 | RRMRRR |
3 | 128 | 135 | RRMRRRRR |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sobic.001G023900.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728013 | 1e-153 | KJ728013.1 Zea mays clone pUT6148 C2C2-GATA transcription factor (GATA18) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002466151.1 | 1e-110 | GATA transcription factor 16 isoform X1 | ||||
TrEMBL | C5WTZ1 | 1e-108 | C5WTZ1_SORBI; Uncharacterized protein | ||||
STRING | Sb01g002270.1 | 1e-109 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2418 | 38 | 92 | Representative plant | OGRP68 | 17 | 287 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 3e-18 | GATA transcription factor 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sobic.001G023900.1.p |
Entrez Gene | 8080199 |