PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_42564.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | Nin-like | ||||||||
Protein Properties | Length: 108aa MW: 11770.6 Da PI: 11.521 | ||||||||
Description | Nin-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | RWP-RK | 91.8 | 5.1e-29 | 15 | 65 | 2 | 52 |
RWP-RK 2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 ek++s + l+++Fs+++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rki+++ Rsa1.0_42564.1_g00001.1 15 EKSVSSSLLQQHFSGSLKDAAKSLGVCPTTLKRICRQHGIMRWPSRKINKV 65 7999*********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51519 | 16.745 | 4 | 85 | IPR003035 | RWP-RK domain |
Pfam | PF02042 | 9.1E-28 | 18 | 65 | IPR003035 | RWP-RK domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
MSKARTPEKK RNSTEKSVSS SLLQQHFSGS LKDAAKSLGV CPTTLKRICR QHGIMRWPSR 60 KINKVNRSLR KIQTVLDSVQ GVEGGLKFDS TTGGFVAVGP FISPPSSN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_42564.1_g00001.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018434817.1 | 7e-67 | PREDICTED: protein NLP8-like | ||||
Swissprot | Q9M1B0 | 2e-54 | NLP9_ARATH; Protein NLP9 | ||||
TrEMBL | A0A178VN39 | 7e-56 | A0A178VN39_ARATH; Uncharacterized protein | ||||
TrEMBL | R0FUG6 | 7e-56 | R0FUG6_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.3706s0034.1.p | 1e-56 | (Capsella grandiflora) | ||||
STRING | XP_006293639.1 | 1e-56 | (Capsella rubella) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G59580.2 | 1e-56 | Nin-like family protein |