PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_34969.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 109aa MW: 12856.9 Da PI: 10.1269 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 136 | 2.5e-42 | 3 | 96 | 36 | 129 |
NAM 36 evdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdW 121 e+d++k+ePwdLpk++k +eke yfF++rd+ky+tg r+nrat+sgyWkatgkdke+++ kg lvg+kktLvfy+grap+gekt+W Rsa1.0_34969.1_g00001.1 3 EADLNKCEPWDLPKMAKMGEKEFYFFCQRDRKYPTGMRTNRATESGYWKATGKDKEIFKGKGCLVGMKKTLVFYRGRAPRGEKTNW 88 78***********9999999***************************************9************************** PP NAM 122 vmheyrle 129 vmheyrle Rsa1.0_34969.1_g00001.1 89 VMHEYRLE 96 ******85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 41.04 | 1 | 109 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.31E-42 | 3 | 97 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.5E-18 | 11 | 95 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 109 aa Download sequence Send to blast |
MGEADLNKCE PWDLPKMAKM GEKEFYFFCQ RDRKYPTGMR TNRATESGYW KATGKDKEIF 60 KGKGCLVGMK KTLVFYRGRA PRGEKTNWVM HEYRLEGIYS YHNLPKTAR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-36 | 1 | 95 | 49 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-36 | 1 | 95 | 49 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-36 | 1 | 95 | 49 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-36 | 1 | 95 | 49 | 142 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
3swm_B | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
3swm_C | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
3swm_D | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
3swp_A | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
3swp_B | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
3swp_C | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
3swp_D | 5e-36 | 1 | 95 | 52 | 145 | NAC domain-containing protein 19 |
4dul_A | 4e-36 | 1 | 95 | 49 | 142 | NAC domain-containing protein 19 |
4dul_B | 4e-36 | 1 | 95 | 49 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_34969.1_g00001.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP641357 | 1e-135 | KP641357.1 Brassica napus NAC transcription factor 87.1 (NAC87.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018473507.1 | 4e-77 | PREDICTED: NAC domain-containing protein 79-like | ||||
Swissprot | Q9FK44 | 2e-73 | NAC87_ARATH; NAC domain-containing protein 87 | ||||
TrEMBL | A0A0D3B1S3 | 1e-74 | A0A0D3B1S3_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g013050.1 | 2e-75 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2269 | 27 | 75 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G18270.1 | 8e-76 | Arabidopsis NAC domain containing protein 87 |
Publications ? help Back to Top | |||
---|---|---|---|
|