PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_30931.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 220aa MW: 24551.4 Da PI: 4.8783 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 76.7 | 5.4e-24 | 1 | 69 | 60 | 129 |
NAM 60 fFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 fF++r kky++g ++nr+t+sgyWk+tgkd++v+ ++e+vg +tLvf+ g++p+ge+tdWv+heyrle Rsa1.0_30931.1_g00001.1 1 FFCPRLKKYPNGGKANRSTESGYWKTTGKDRDVTY-NDEVVGKIRTLVFHYGKTPRGERTDWVIHEYRLE 69 9**********************************.999*****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.03E-29 | 1 | 91 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 33.622 | 1 | 91 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.6E-10 | 1 | 68 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 220 aa Download sequence Send to blast |
FFCPRLKKYP NGGKANRSTE SGYWKTTGKD RDVTYNDEVV GKIRTLVFHY GKTPRGERTD 60 WVIHEYRLED RTLVQRNIPQ DTYVICKLFK KKGLGPRHGS EYGAPFKDED WSDEEDIESL 120 VAIPDPGPNK VPSVVASASR SHPPEDCITR VISESCVSDV PQLTAAVLPP LASDVVAHTP 180 LSSSSSPLLE VPHAVQDDDD FYSMLDLFVV DSDESLRLDG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-23 | 1 | 92 | 75 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-23 | 1 | 92 | 75 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-23 | 1 | 92 | 75 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-23 | 1 | 92 | 75 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-23 | 1 | 92 | 78 | 169 | NAC domain-containing protein 19 |
3swm_B | 4e-23 | 1 | 92 | 78 | 169 | NAC domain-containing protein 19 |
3swm_C | 4e-23 | 1 | 92 | 78 | 169 | NAC domain-containing protein 19 |
3swm_D | 4e-23 | 1 | 92 | 78 | 169 | NAC domain-containing protein 19 |
3swp_A | 4e-23 | 1 | 92 | 78 | 169 | NAC domain-containing protein 19 |
3swp_B | 4e-23 | 1 | 92 | 78 | 169 | NAC domain-containing protein 19 |
3swp_C | 4e-23 | 1 | 92 | 78 | 169 | NAC domain-containing protein 19 |
3swp_D | 4e-23 | 1 | 92 | 78 | 169 | NAC domain-containing protein 19 |
4dul_A | 4e-23 | 1 | 92 | 75 | 166 | NAC domain-containing protein 19 |
4dul_B | 4e-23 | 1 | 92 | 75 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_30931.1_g00001.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF738277 | 0.0 | KF738277.1 Brassica napus NAC transcription factor 103 (NAC103.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018488475.1 | 1e-155 | PREDICTED: NAC domain-containing protein 82 isoform X2 | ||||
Swissprot | Q9FY82 | 8e-70 | NAC82_ARATH; NAC domain-containing protein 82 | ||||
TrEMBL | A0A397Z781 | 1e-137 | A0A397Z781_BRACM; Uncharacterized protein | ||||
STRING | Bra024263.1-P | 1e-137 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3692 | 25 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64060.1 | 5e-92 | NAC domain containing protein 103 |
Publications ? help Back to Top | |||
---|---|---|---|
|