PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Rsa1.0_26510.1_g00001.1

Organism

Raphanus sativus

Taxonomic ID

3726

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

M-type_MADS

Protein Properties

Length: 85aa MW: 9619.34 Da PI: 10.2882

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Rsa1.0_26510.1_g00001.1	genome	RGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	82.7	2.3e-26	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien nr vtfskRrng+ KKA+E+ vLCda+va+iif+s+gk+ +y+ Rsa1.0_26510.1_g00001.1 9 KRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIIFASNGKMTDYC 58 79*********************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	30.375	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	6.6E-38	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	7.46E-33	2	85	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.00E-38	2	80	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.1E-27	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.1E-22	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.1E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.1E-27	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
MGRGKIEIKR IENANNRVVT FSKRRNGLVK KAKEITVLCD AKVALIIFAS NGKMTDYCCP 60 SMDLGAMLDQ YQKLSGKKLW DTKHE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	7e-18	1	63	1	63	MEF2 CHIMERA
6byy_B	7e-18	1	63	1	63	MEF2 CHIMERA
6byy_C	7e-18	1	63	1	63	MEF2 CHIMERA
6byy_D	7e-18	1	63	1	63	MEF2 CHIMERA
6bz1_A	7e-18	1	63	1	63	MEF2 CHIMERA
6bz1_B	7e-18	1	63	1	63	MEF2 CHIMERA
6bz1_C	7e-18	1	63	1	63	MEF2 CHIMERA
6bz1_D	7e-18	1	63	1	63	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with APETALA3 that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269\|PubMed:18417639, ECO:0000269\|PubMed:8565821, ECO:0000269\|PubMed:9489703}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Rsa1.0_26510.1_g00001.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269\|PubMed:11283333, ECO:0000269\|PubMed:19783648}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC967961	1e-116	KC967961.1 Brassica oleracea var. viridis PI.a (PI.a) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018468560.1	1e-57	PREDICTED: floral homeotic protein PISTILLATA-like isoform X1
Refseq	XP_018468565.1	1e-57	PREDICTED: floral homeotic protein PISTILLATA-like isoform X1
Swissprot	P48007	4e-57	PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBL	A0A3N6PUD3	2e-55	A0A3N6PUD3_BRACR; Uncharacterized protein
TrEMBL	R0GXD9	2e-55	R0GXD9_9BRAS; Uncharacterized protein
STRING	Cagra.0179s0008.1.p	2e-56	(Capsella grandiflora)
STRING	XP_006288656.1	3e-56	(Capsella rubella)
STRING	XP_010420863.1	3e-56	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM5300	27	51

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G20240.1	2e-59	MIKC_MADS family protein

Publications ? help Back to Top
Zhang Y, et al. A cucumber DELLA homolog CsGAIP may inhibit staminate development through transcriptional repression of B class floral homeotic genes. PLoS ONE, 2014. 9(3): p. e91804 [PMID:24632777] Jing D, et al. Ectopic expression of a Catalpa bungei (Bignoniaceae) PISTILLATA homologue rescues the petal and stamen identities in Arabidopsis pi-1 mutant. Plant Sci., 2015. 231: p. 40-51 [PMID:25575990] Behrend A,Borchert T,Hohe A "The usual suspects"- analysis of transcriptome sequences reveals deviating B gene activity in C. vulgaris bud bloomers. BMC Plant Biol., 2015. 15: p. 8 [PMID:25604890] Morroll SM,Wilson ZA Arabidopsis YAC restriction mapping. Genome, 1998. 41(6): p. 806-17 [PMID:9924791]