PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_17595.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 163aa MW: 18929.7 Da PI: 9.573 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 164.7 | 3.4e-51 | 17 | 141 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 pGfrFhPtdeel+ +yL++kve+k+++l e ik+vdiyk++PwdLp+ + +ekewyfF+ r +ky+++ r+nr+t sg+Wkatg Rsa1.0_17595.1_g00001.1 17 LPGFRFHPTDEELLEYYLRRKVENKPIKL-ELIKQVDIYKYDPWDLPRVSSVGEKEWYFFCMRGRKYRNSVRPNRVTGSGFWKATG 101 59***************************.99***************7777799******************************** PP NAM 88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 dk+v+s + vglkk+Lv+y g+a kg+ktdW+mhe+rl Rsa1.0_17595.1_g00001.1 102 IDKPVYS-NLDCVGLKKSLVYYLGSAGKGTKTDWMMHEFRL 141 *******.9999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.11E-55 | 16 | 150 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 49.628 | 16 | 163 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.9E-26 | 18 | 141 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MSGEGSKGHQ EEDETKLPGF RFHPTDEELL EYYLRRKVEN KPIKLELIKQ VDIYKYDPWD 60 LPRVSSVGEK EWYFFCMRGR KYRNSVRPNR VTGSGFWKAT GIDKPVYSNL DCVGLKKSLV 120 YYLGSAGKGT KTDWMMHEFR LPSTTKTDLS VQQAVSSISL KYI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 2e-50 | 8 | 152 | 8 | 156 | NAC domain-containing protein 19 |
3swm_B | 2e-50 | 8 | 152 | 8 | 156 | NAC domain-containing protein 19 |
3swm_C | 2e-50 | 8 | 152 | 8 | 156 | NAC domain-containing protein 19 |
3swm_D | 2e-50 | 8 | 152 | 8 | 156 | NAC domain-containing protein 19 |
3swp_A | 2e-50 | 8 | 152 | 8 | 156 | NAC domain-containing protein 19 |
3swp_B | 2e-50 | 8 | 152 | 8 | 156 | NAC domain-containing protein 19 |
3swp_C | 2e-50 | 8 | 152 | 8 | 156 | NAC domain-containing protein 19 |
3swp_D | 2e-50 | 8 | 152 | 8 | 156 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_17595.1_g00001.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM975669 | 0.0 | KM975669.1 Brassica napus NAC transcription factor 42.1 (NAC42.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018437806.1 | 1e-119 | PREDICTED: transcription factor JUNGBRUNNEN 1-like | ||||
Swissprot | Q9SK55 | 1e-101 | NAC42_ARATH; Transcription factor JUNGBRUNNEN 1 | ||||
TrEMBL | A0A078IW82 | 1e-105 | A0A078IW82_BRANA; BnaC04g52880D protein | ||||
TrEMBL | A0A0B5KN57 | 1e-105 | A0A0B5KN57_BRANA; NAC transcription factor 42.1 | ||||
TrEMBL | A0A3P6C4N4 | 1e-105 | A0A3P6C4N4_BRAOL; Uncharacterized protein | ||||
STRING | Bra004736.1-P | 1e-106 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM306 | 28 | 200 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G43000.1 | 1e-104 | NAC domain containing protein 42 |