PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_16435.1_g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 124aa MW: 14350 Da PI: 10.0305 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 43 | 1.1e-13 | 9 | 53 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W++ E++l++ + k++G+g+W++I+r + +Rt+ q+ s+ qky Rsa1.0_16435.1_g00002.1 9 PWSENEHKLFLIGLKRYGKGDWRSISRNVVVTRTPTQVASHAQKY 53 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.97 | 2 | 58 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.47E-16 | 3 | 59 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.0E-16 | 5 | 57 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 1.5E-8 | 6 | 56 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-10 | 8 | 52 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.87E-8 | 9 | 54 | No hit | No description |
Pfam | PF00249 | 1.3E-11 | 9 | 53 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
ETERKRGTPW SENEHKLFLI GLKRYGKGDW RSISRNVVVT RTPTQVASHA QKYFLRQNSV 60 KKERKRSSIH DITTVDTNLA MPGSNMDWTG LQESSVQTQQ QQSMSEFGQE LTPGGHYEEF 120 GYRM |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_16435.1_g00002.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013622270.1 | 1e-84 | PREDICTED: transcription factor DIVARICATA-like | ||||
Refseq | XP_013653806.1 | 1e-84 | transcription factor DIVARICATA-like | ||||
Swissprot | Q8S9H7 | 2e-36 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A0D3AZR1 | 3e-83 | A0A0D3AZR1_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6AJ62 | 3e-83 | A0A3P6AJ62_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g002960.1 | 5e-84 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5127 | 27 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 2e-64 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|