PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_15187.1_g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 240aa MW: 27236.9 Da PI: 9.403 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 167.1 | 6.1e-52 | 13 | 141 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 lp+G+rF+Ptdeelv +yL++k++g++ ++ ++i+e+di+k+ePwdLp + +k++++ew fF++ d+ky++g+r+nrat +gyWk Rsa1.0_15187.1_g00002.1 13 LPVGLRFRPTDEELVRFYLRRKINGHDDDV-KAIREIDICKWEPWDLPgfSVIKTNDSEWLFFCPLDRKYPNGSRQNRATIAGYWK 97 799************************999.89***************6448888999**************************** PP NAM 85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 atgkd++++s++++ +g+k+tLvf++grapkg++t+W+mheyr+ Rsa1.0_15187.1_g00002.1 98 ATGKDRKIKSSRNSIIGVKRTLVFHSGRAPKGTRTNWIMHEYRA 141 ******************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.62E-58 | 9 | 164 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.102 | 13 | 164 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.0E-25 | 14 | 140 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 240 aa Download sequence Send to blast |
MNQNIKVLTL DSLPVGLRFR PTDEELVRFY LRRKINGHDD DVKAIREIDI CKWEPWDLPG 60 FSVIKTNDSE WLFFCPLDRK YPNGSRQNRA TIAGYWKATG KDRKIKSSRN SIIGVKRTLV 120 FHSGRAPKGT RTNWIMHEYR ATEDDLRGTN PGQSPFVICK LFKKQELSLE DEAAEPAVSS 180 SPTSSPDETK SEVSVVVKTE DVKRYDVAES SLVVSSGEAT TAKVRTLQSF NFRSLSVVFC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 3e-51 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
3swm_B | 3e-51 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
3swm_C | 3e-51 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
3swm_D | 3e-51 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
3swp_A | 3e-51 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
3swp_B | 3e-51 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
3swp_C | 3e-51 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
3swp_D | 3e-51 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:20156199, PubMed:19947982). Transcriptional activator involved in response to cold stress. Mediates induction of pathogenesis-related (PR) genes independently of salicylic signaling in response to cold. Binds directly to the PR gene promoters and enhances plant resistance to pathogen infection, incorporating cold signals into pathogen resistance responses (PubMed:19947982). Plays a regulatory role in abscisic acid (ABA)-mediated drought-resistance response (PubMed:22967043). {ECO:0000269|PubMed:19947982, ECO:0000269|PubMed:20156199, ECO:0000269|PubMed:22967043}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_15187.1_g00002.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salt, drought stress, abscisic acid (ABA), salicylic acid (SA) and methyl methanesulfonate (MMS) treatment. {ECO:0000269|PubMed:17158162}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP641353 | 0.0 | KP641353.1 Brassica napus NAC transcription factor 62-1.1 (NAC62-1.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018441133.1 | 1e-165 | PREDICTED: NAC domain-containing protein 62-like | ||||
Swissprot | Q9SCK6 | 1e-130 | NAC62_ARATH; NAC domain-containing protein 62 | ||||
TrEMBL | A0A0X9GD10 | 1e-143 | A0A0X9GD10_BRANA; NAC transcription factor 62-1.1 | ||||
STRING | Bra017980.1-P | 1e-142 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2416 | 28 | 73 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49530.1 | 1e-133 | NAC domain containing protein 62 |
Publications ? help Back to Top | |||
---|---|---|---|
|