PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Rsa1.0_10740.1_g00001.1

Organism

Raphanus sativus

Taxonomic ID

3726

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

M-type_MADS

Protein Properties

Length: 61aa MW: 6944.11 Da PI: 10.5644

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Rsa1.0_10740.1_g00001.1	genome	RGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	92.7	1.8e-29	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie+ + rqvtfskRr+g+lKKA+ELSvLCda+va i+fs+tg+ly+++s Rsa1.0_10740.1_g00001.1 9 KRIEDMTSRQVTFSKRRKGLLKKAHELSVLCDAQVAAIVFSQTGRLYDFAS 59 79***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.399	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.6E-40	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.83E-28	3	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	6.26E-36	3	60	No hit	No description
PRINTS	PR00404	5.9E-30	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	9.3E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.9E-30	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.9E-30	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
MVRGKIEIKR IEDMTSRQVT FSKRRKGLLK KAHELSVLCD AQVAAIVFSQ TGRLYDFASS 60 E

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	3e-19	1	61	1	61	MEF2C
5f28_B	3e-19	1	61	1	61	MEF2C
5f28_C	3e-19	1	61	1	61	MEF2C
5f28_D	3e-19	1	61	1	61	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269\|PubMed:21609362}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Rsa1.0_10740.1_g00001.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC189309	2e-80	AC189309.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB034C07, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013605259.1	7e-34	PREDICTED: MADS-box transcription factor 23-like isoform X1
Refseq	XP_013605260.1	7e-34	PREDICTED: MADS-box protein SOC1-like isoform X2
Refseq	XP_022567624.1	7e-34	MADS-box protein AGL71-like
Swissprot	Q9FLH5	6e-31	AGL72_ARATH; MADS-box protein AGL72
TrEMBL	A0A3N6QIC0	2e-34	A0A3N6QIC0_BRACR; Uncharacterized protein
STRING	Bo7g110310.1	8e-35	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G51860.2	2e-33	MIKC_MADS family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]