PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_06065.1_g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 179aa MW: 20532 Da PI: 10.2204 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 133.4 | 7.6e-42 | 60 | 136 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cqv++C++dl+eak+yhrrhkvCevh+ka++v+++g++qrfCqqCsrfhel efDe+krsCr+rLa+hnerrrk+++ Rsa1.0_06065.1_g00002.1 60 CQVDRCTSDLKEAKQYHRRHKVCEVHAKASSVYLTGVKQRFCQQCSRFHELLEFDEAKRSCRKRLAGHNERRRKSSS 136 **************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 6.4E-58 | 1 | 147 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 1.5E-32 | 54 | 121 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.804 | 57 | 134 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 3.4E-38 | 59 | 138 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 6.8E-32 | 60 | 133 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MDGKKTQGKG YLKKKASVSY LVEEEMENDT DGEEEEKRKG VTDRFKGSTG SNDRGSSRLC 60 QVDRCTSDLK EAKQYHRRHK VCEVHAKASS VYLTGVKQRF CQQCSRFHEL LEFDEAKRSC 120 RKRLAGHNER RRKSSSESVG EGSGGRRGIT AQMIQNQERS RVDMTFPMSN TSFKRPQIR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-44 | 47 | 133 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_06065.1_g00002.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK353439 | 1e-115 | AK353439.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-30-M04. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013590498.1 | 1e-116 | PREDICTED: squamosa promoter-binding-like protein 4 | ||||
Swissprot | Q9S758 | 9e-81 | SPL5_ARATH; Squamosa promoter-binding-like protein 5 | ||||
TrEMBL | A0A397YVS3 | 1e-121 | A0A397YVS3_BRACM; Squamosa promoter-binding-like protein | ||||
STRING | Bo6g031220.1 | 1e-115 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM868 | 28 | 118 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 5e-63 | squamosa promoter binding protein-like 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|