PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_05799.1_g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 235aa MW: 26663 Da PI: 6.1539 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 137 | 1.2e-42 | 6 | 137 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgy 82 + GfrF Pt++elv +yL++++eg++ ++++vi+ +d+++veP++Lp+ +++++ ++w+fF++r++++a+g r++r+t sgy Rsa1.0_05799.1_g00002.1 6 TIGFRFYPTEDELVAFYLRNQLEGRSdDSMHRVIPVLDVFEVEPSHLPNvageRCRGDAEQWFFFVPRQEREARGGRPSRTTGSGY 91 68***********************95555677***************646666666888************************** PP NAM 83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 Wkatg+ +v+sk+++ +g+kkt+vfy+g+ap+g+kt+W m+ey++ Rsa1.0_05799.1_g00002.1 92 WKATGSPGPVISKDNRMIGVKKTMVFYTGKAPTGRKTKWKMNEYKA 137 ********************************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.89E-47 | 4 | 162 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 47.053 | 5 | 162 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.5E-23 | 7 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 235 aa Download sequence Send to blast |
MAEELTIGFR FYPTEDELVA FYLRNQLEGR SDDSMHRVIP VLDVFEVEPS HLPNVAGERC 60 RGDAEQWFFF VPRQEREARG GRPSRTTGSG YWKATGSPGP VISKDNRMIG VKKTMVFYTG 120 KAPTGRKTKW KMNEYKAVDE TVNVSTIPKL RHEFSLCRVY ITSGSSRAFD RRPVGSFQTE 180 RMLTSDVGVA ETSFRVGSSP ETSMSGGEHV DLSVNTEMVD ALTEPMWEWE QLNWS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-33 | 5 | 167 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-33 | 5 | 167 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-33 | 5 | 167 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-33 | 5 | 167 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-33 | 5 | 167 | 20 | 173 | NAC domain-containing protein 19 |
3swm_B | 4e-33 | 5 | 167 | 20 | 173 | NAC domain-containing protein 19 |
3swm_C | 4e-33 | 5 | 167 | 20 | 173 | NAC domain-containing protein 19 |
3swm_D | 4e-33 | 5 | 167 | 20 | 173 | NAC domain-containing protein 19 |
3swp_A | 4e-33 | 5 | 167 | 20 | 173 | NAC domain-containing protein 19 |
3swp_B | 4e-33 | 5 | 167 | 20 | 173 | NAC domain-containing protein 19 |
3swp_C | 4e-33 | 5 | 167 | 20 | 173 | NAC domain-containing protein 19 |
3swp_D | 4e-33 | 5 | 167 | 20 | 173 | NAC domain-containing protein 19 |
4dul_A | 4e-33 | 5 | 167 | 17 | 170 | NAC domain-containing protein 19 |
4dul_B | 4e-33 | 5 | 167 | 17 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_05799.1_g00002.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK175806 | 0.0 | AK175806.1 Arabidopsis thaliana mRNA for NAC-domain protein-like, complete cds, clone: RAFL22-40-G20. | |||
GenBank | AY086944 | 0.0 | AY086944.1 Arabidopsis thaliana clone 29829 mRNA, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018471145.1 | 1e-175 | PREDICTED: NAC domain-containing protein 90 | ||||
Swissprot | Q9FMR3 | 1e-156 | NAC90_ARATH; NAC domain-containing protein 90 | ||||
TrEMBL | A0A078F7X3 | 1e-169 | A0A078F7X3_BRANA; BnaA02g05600D protein | ||||
TrEMBL | A0A0D3AKG1 | 1e-169 | A0A0D3AKG1_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A398A7Q2 | 1e-169 | A0A398A7Q2_BRACM; Uncharacterized protein | ||||
TrEMBL | M4DUJ5 | 1e-169 | M4DUJ5_BRARP; Uncharacterized protein | ||||
STRING | Bra020188.1-P | 1e-170 | (Brassica rapa) | ||||
STRING | Bo2g023870.1 | 1e-170 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1445 | 28 | 93 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G22380.1 | 1e-147 | NAC domain containing protein 90 |
Publications ? help Back to Top | |||
---|---|---|---|
|