PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_03192.1_g00003.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 150aa MW: 16658.3 Da PI: 7.5009 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 27.8 | 5.7e-09 | 5 | 37 | 15 | 47 |
HHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 15 avkqlGggtWktIartmgkgRtlkqcksrwqky 47 + k++G+g+W+ Iar + ++Rt+ q+ s+ qky Rsa1.0_03192.1_g00003.1 5 GLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 37 789*****************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.073 | 1 | 42 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.07E-10 | 1 | 41 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.10E-6 | 1 | 38 | No hit | No description |
TIGRFAMs | TIGR01557 | 1.1E-10 | 2 | 41 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.1E-6 | 3 | 37 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.2E-6 | 5 | 37 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
QFLIGLKKYG KGDWRNIARN FVTTRTPTQV ASHAQKYFIR QVNGGKDKRR SSIHDITTVN 60 VPDSPDTGAA DTSTANAPCS PPSLGGSQRE ASDQWEGQTI YDETSAAFYN QNAFQETLLG 120 MSSTPYMAKL QEQSFLNASQ FESYNAYLQM |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_03192.1_g00003.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018433585.1 | 1e-108 | PREDICTED: transcription factor DIVARICATA | ||||
Swissprot | Q8S9H7 | 6e-36 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | V4MIQ7 | 6e-93 | V4MIQ7_EUTSA; Uncharacterized protein | ||||
STRING | XP_010517093.1 | 4e-95 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1228 | 27 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38090.1 | 5e-94 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|