PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_02926.1_g00004.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 90aa MW: 10518.2 Da PI: 10.436 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.9 | 1e-17 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W++eEd++l+ ++++G ++W++ +++ g+ R++k+c++rw +yl Rsa1.0_02926.1_g00004.1 16 RGPWSPEEDLKLISFIQKFGHENWRSLPKKSGLLRCGKSCRLRWINYL 63 89******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.4E-25 | 7 | 66 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.573 | 11 | 67 | IPR017930 | Myb domain |
SMART | SM00717 | 1.2E-13 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.8E-16 | 16 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.28E-23 | 17 | 90 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.47E-10 | 18 | 63 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.4E-11 | 67 | 90 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 8.718 | 68 | 90 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MGKGRAPCCD KTKVKRGPWS PEEDLKLISF IQKFGHENWR SLPKKSGLLR CGKSCRLRWI 60 NYLRPDVKRG NFTAEEEETI IKLHQNYGNK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-15 | 16 | 90 | 7 | 80 | B-MYB |
1gv2_A | 3e-15 | 16 | 90 | 4 | 77 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 3e-15 | 16 | 90 | 4 | 77 | C-Myb DNA-Binding Domain |
1msf_C | 3e-15 | 16 | 90 | 4 | 77 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269|PubMed:19122102}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_02926.1_g00004.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by UV light (PubMed:9839469). Triggered by salicylic acid and jasmonic acid (PubMed:16463103). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK175344 | 1e-100 | AK175344.1 Arabidopsis thaliana mRNA for putative transcription factor (MYB63), complete cds, clone: RAFL21-78-M22. | |||
GenBank | AY519572 | 1e-100 | AY519572.1 Arabidopsis thaliana MYB transcription factor (At1g79180) mRNA, complete cds. | |||
GenBank | BT033125 | 1e-100 | BT033125.1 Arabidopsis thaliana unknown protein (At1g79180) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009104545.1 | 3e-61 | PREDICTED: myb-related protein Zm1-like | ||||
Swissprot | Q6R0A6 | 4e-60 | MYB63_ARATH; Transcription factor MYB63 | ||||
TrEMBL | A0A397YN19 | 8e-60 | A0A397YN19_BRACM; Uncharacterized protein | ||||
TrEMBL | A0A3P6BS43 | 8e-60 | A0A3P6BS43_BRACM; Uncharacterized protein | ||||
TrEMBL | M4CHD6 | 8e-60 | M4CHD6_BRARP; Uncharacterized protein | ||||
STRING | Bra003619.1-P | 1e-60 | (Brassica rapa) | ||||
STRING | Bostr.20129s0353.1.p | 1e-60 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G79180.1 | 2e-62 | myb domain protein 63 |
Publications ? help Back to Top | |||
---|---|---|---|
|