PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_01570.1_g00007.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 195aa MW: 22542.7 Da PI: 9.8458 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54 | 3.8e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W +eEd +l ++v+ +G g+W+ I+r+ g++R++k+c++rw +yl Rsa1.0_01570.1_g00007.1 14 RGLWKPEEDVILRRCVESHGEGNWADISRRSGLKRSGKSCRLRWKNYL 61 788*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 50.3 | 5.3e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg ++++E++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l Rsa1.0_01570.1_g00007.1 67 RGGMSPQEQDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 112 6779******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.1E-22 | 8 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.926 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.39E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.9E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.47E-11 | 17 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.2E-23 | 65 | 115 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.831 | 66 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 2.2E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-14 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.69E-11 | 70 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010026 | Biological Process | trichome differentiation | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MEKREEKRKS NVKRGLWKPE EDVILRRCVE SHGEGNWADI SRRSGLKRSG KSCRLRWKNY 60 LRPNIKRGGM SPQEQDLIIR MHKLLGNRWS LIAGRLPGRT DNEVKNYWNT HLNKKSNSRI 120 QNGPELVEAS PDKPVMSTGV RQSHGEEVTI TNWVEETNYF GYDVCMGSPL PLISHYTDNL 180 VFDPCSAFAD FFPLL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 9e-23 | 14 | 118 | 7 | 110 | B-MYB |
1h8a_C | 2e-22 | 14 | 115 | 27 | 127 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activation factor positively regulating trichomes development (PubMed:24803498). Has a function nearly equivalent to that of GL1 and can complement gl1 mutants (PubMed:24803498). {ECO:0000269|PubMed:24803498}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_01570.1_g00007.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin (IAA). {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519637 | 1e-107 | AY519637.1 Arabidopsis thaliana MYB transcription factor (At5g52600) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018474701.1 | 1e-139 | PREDICTED: transcription factor MYB82-like | ||||
Swissprot | Q9LTF7 | 1e-109 | MYB82_ARATH; Transcription factor MYB82 | ||||
TrEMBL | A0A078J210 | 1e-112 | A0A078J210_BRANA; BnaA03g12580D protein | ||||
TrEMBL | A0A397ZUR0 | 1e-112 | A0A397ZUR0_BRACM; Uncharacterized protein | ||||
TrEMBL | M4EJZ6 | 1e-112 | M4EJZ6_BRARP; Uncharacterized protein | ||||
STRING | Bra029113.1-P | 1e-113 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G52600.1 | 2e-99 | myb domain protein 82 |