PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_01336.1_g00006.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 132aa MW: 14738.6 Da PI: 7.2424 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 141 | 3.9e-44 | 12 | 110 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 +CaaCk+lrrkC++dCv+apyfp e+p kfanvh++FGasnv+k+l+++ +++reda++sl+yeAear+rdPvyG+vg i+ lq+q Rsa1.0_01336.1_g00006.1 12 PCAACKFLRRKCTSDCVFAPYFPPEEPTKFANVHRIFGASNVSKILQEVAPHQREDAVNSLAYEAEARLRDPVYGCVGAISVLQRQ 97 7************************************************************************************* PP DUF260 87 leqlkaelallke 99 + l+ el+++++ Rsa1.0_01336.1_g00006.1 98 VLGLQRELEETNA 110 ********99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.229 | 11 | 112 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 6.8E-44 | 12 | 109 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MSSSYFNYTN SPCAACKFLR RKCTSDCVFA PYFPPEEPTK FANVHRIFGA SNVSKILQEV 60 APHQREDAVN SLAYEAEARL RDPVYGCVGA ISVLQRQVLG LQRELEETNA DIMRYASYLG 120 GETASVYGDR RG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-58 | 10 | 121 | 9 | 121 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-58 | 10 | 121 | 9 | 121 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_01336.1_g00006.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018485338.1 | 3e-95 | PREDICTED: LOB domain-containing protein 25-like | ||||
Swissprot | Q8L8Q3 | 3e-84 | LBD25_ARATH; LOB domain-containing protein 25 | ||||
TrEMBL | A0A078FH29 | 3e-84 | A0A078FH29_BRANA; BnaA06g31930D protein | ||||
TrEMBL | A0A291LQZ5 | 3e-84 | A0A291LQZ5_BRARR; Transcription factor LBD25a | ||||
TrEMBL | A0A397Z3H9 | 3e-84 | A0A397Z3H9_BRACM; Uncharacterized protein | ||||
TrEMBL | M4E938 | 3e-84 | M4E938_BRARP; Uncharacterized protein | ||||
STRING | Bra025294.1-P | 5e-85 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27650.1 | 1e-86 | LOB domain-containing protein 25 |
Publications ? help Back to Top | |||
---|---|---|---|
|