PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00384.1_g00003.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 120aa MW: 13954 Da PI: 9.5136 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 55 | 1.4e-17 | 18 | 105 | 1 | 90 |
EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS B3 1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 f++ +++ ++l++ l+lp +f+ +g+++++ ++tl d+ g + + l+ +++sg++ ++kGW+eF++ang+k+g+++ ++l++ Rsa1.0_00384.1_g00003.1 18 FLTLTLTTYNLRKYKLCLPGNFVWLNGMDNAR--KITLVDRYGFKRTTSLRPDNNSGKMRMGKGWREFCEANGVKVGESFKLELIK 101 677788999*****************999665..8********999999988********************************98 PP SSEE CS B3 87 rsef 90 ++e+ Rsa1.0_00384.1_g00003.1 102 EEEE 105 7443 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.40.330.10 | 7.1E-18 | 10 | 117 | IPR015300 | DNA-binding pseudobarrel domain |
SuperFamily | SSF101936 | 3.73E-19 | 14 | 103 | IPR015300 | DNA-binding pseudobarrel domain |
SMART | SM01019 | 6.7E-18 | 18 | 120 | IPR003340 | B3 DNA binding domain |
PROSITE profile | PS50863 | 12.167 | 18 | 119 | IPR003340 | B3 DNA binding domain |
Pfam | PF02362 | 8.7E-16 | 18 | 105 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 4.55E-14 | 28 | 101 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MYNRDSLRAS SSTSQERFLT LTLTTYNLRK YKLCLPGNFV WLNGMDNARK ITLVDRYGFK 60 RTTSLRPDNN SGKMRMGKGW REFCEANGVK VGESFKLELI KEEEEEEDTA IHLLKFCSKV |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00384.1_g00003.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009146779.1 | 4e-57 | PREDICTED: B3 domain-containing protein REM7-like | ||||
TrEMBL | A0A3P5Z1E5 | 7e-58 | A0A3P5Z1E5_BRACM; Uncharacterized protein | ||||
STRING | Bra029892.1-P | 2e-56 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM204 | 22 | 261 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G24700.1 | 2e-22 | B3 family protein |