PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00236.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family STAT
Protein Properties Length: 688aa    MW: 77604.2 Da    PI: 4.5315
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00236.1_g00013.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT160.73.2e-502253311111
                     STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrik 86 
                              +dvvl+na+gqpv+kdv+vvasLlya+sg++vek++d eapLL+s dGvefs+ed+p++ll+G+as+klkisq    cd+rLf+ik
  Rsa1.0_00236.1_g00013.1 225 MDVVLSNAIGQPVRKDVQVVASLLYANSGTPVEKTSDLEAPLLVSSDGVEFSAEDKPCNLLNGCASLKLKISQ----CDKRLFCIK 306
                              69*********************************************************************98....********* PP

                     STAT  87 feipklkkypfleavskpirCisrs 111
                              feip+  +ypfleav++++rCisr 
  Rsa1.0_00236.1_g00013.1 307 FEIPNKGSYPFLEAVTNQMRCISRI 331
                              ***********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF133856.1E-728174No hitNo description
SuperFamilySSF498992.53E-729166IPR013320Concanavalin A-like lectin/glucanase domain
CDDcd103381.92E-66583688No hitNo description
Gene3DG3DSA:3.30.505.104.3E-8591642IPR000980SH2 domain
SuperFamilySSF555507.04E-12591679IPR000980SH2 domain
PROSITE profilePS500019.959594647IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
MADDCALDTE KYSLLEDFNV DVEVGKQEFE TFSLCFWVYL LDSTTYPSTI IRQVHSDMSF  60
SAPFLVLDEN KKMILLPLTL LHKEAPDPVN TASWTEVPNV STTAEFPLQK WVHVGCEVSR  120
TYMRLYICGE IAGEKVLTSV MTSGTNSDYV RRRVSLFSVG GDGYSVQGFI HCAEVLPSTL  180
HVNNHYTKDP PLWLSVEKPS SCEIDEDGVW SIVGEKASCG MIFSMDVVLS NAIGQPVRKD  240
VQVVASLLYA NSGTPVEKTS DLEAPLLVSS DGVEFSAEDK PCNLLNGCAS LKLKISQCDK  300
RLFCIKFEIP NKGSYPFLEA VTNQMRCISR ITGGDSVTPK RLNHPLVEGG VPSSNGASDS  360
SLSMKRIKLG EEKIPESEFE DGNGTSMEWR PQRHDDEEEE EEEEEEEEEE EEEEEEEDHS  420
STDSENTEVR GSTGSRKYTI SDSMIFRYCL GNLTERSLLL KEVTNNSGDE EVSEFADQVS  480
LYSGCSHHGN QIKMARKLIA EGTNAWILIS RNYQHVHWDN VVIEIEEHFM RIAKCSSRSL  540
THQDFELLRR ICGCYDYITQ ENFERMWCWL FPVATAISSR GLINGMWRSC SPKWIEGFVT  600
KEEAEHSLQS QEPGTFILRF PTSRSWPHPD AGSLVVTYVG HDFVIRHRLL AVDHICDSSE  660
RYTDAKPLQD MLLAEPELSR LGRIVRSI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1361368LSMKRIKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00236.1_g00013.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018468989.10.0PREDICTED: uncharacterized protein LOC108840562 isoform X2
SwissprotB5X5610.0SHA_ARATH; SH2 domain-containing protein A
TrEMBLA0A397YWK80.0A0A397YWK8_BRACM; Uncharacterized protein
STRINGBo5g022370.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52052645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17040.10.0SH2 domain protein A
Publications ? help Back to Top
  1. Yamada Y,Wang HY,Fukuzawa M,Barton GJ,Williams JG
    A new family of transcription factors.
    Development, 2008. 135(18): p. 3093-101
    [PMID:18701541]